Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.40
PubTator Score 6.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma -1.100 9.2e-03
esophageal adenocarcinoma -1.100 1.8e-02
group 3 medulloblastoma 2.200 1.5e-04
lung adenocarcinoma -1.300 2.3e-07
malignant mesothelioma -2.100 3.4e-07
osteosarcoma 3.078 9.6e-06
ovarian cancer -1.600 3.4e-06
psoriasis 1.300 8.2e-04

Protein-protein Interaction (4)

Gene RIF (3)

AA Sequence

MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGI      1 - 70
TFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQP     71 - 140
GALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQQGLERLYEMILKRKKAARGGKKRR             141 - 201
//

Text Mined References (16)

PMID Year Title