Property Summary

NCBI Gene PubMed Count 20
PubMed Score 234.36
PubTator Score 516.98

Knowledge Summary

Patent (18,128)

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus 1.100 1.1e-03
lung adenocarcinoma 1.600 4.2e-07
osteosarcoma 1.138 2.7e-05
psoriasis 1.900 6.5e-17

Gene RIF (14)

AA Sequence

MDPEETSVYLDYYYATSPNSDIRETHSHVPYTSVFLPVFYTAVFLTGVLGNLVLMGALHFKPGSRRLIDI      1 - 70
FIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCSVLLLTCMSVDRYLAIVWPVV     71 - 140
SRKFRRTDCAYVVCASIWFISCLLGLPTLLSRELTLIDDKPYCAEKKATPIKLIWSLVALIFTFFVPLLS    141 - 210
IVTCYCCIARKLCAHYQQSGKHNKKLKKSIKIIFIVVAAFLVSWLPFNTFKFLAIVSGLRQEHYLPSAIL    211 - 280
QLGMEVSGPLAFANSCVNPFIYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDF    281 - 350
ARRRKRSVSL                                                                351 - 360
//

Text Mined References (20)

PMID Year Title