Property Summary

Ligand Count 80
NCBI Gene PubMed Count 24
PubMed Score 14.20
PubTator Score 29.83

Knowledge Summary

Patent (10,917)

TINX Plot

  Disease (3)

Disease Target Count P-value
pituitary cancer 1972 1.3e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
pancreatic cancer 2398 0.0 3.0

Expression

  Differential Expression (1)

Disease log2 FC p
pituitary cancer 1.600 1.3e-05

Gene RIF (13)

AA Sequence

MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLKGLIVLLYSVV      1 - 70
VVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAYAFEPRGWVFGGGLCHLVFFL     71 - 140
QPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAVLAIWALSAVLALPAAVHTYHVELKPHDVRL    141 - 210
CEEFWGSQERQRQLYAWGLLLVTYLLPLLVILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLL    211 - 280
VVIVVVFAVCWLPLHVFNLLRDLDPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLL    281 - 350
VAWPRKIAPHGQNMTVSVVI                                                      351 - 370
//

Text Mined References (24)

PMID Year Title