Property Summary

NCBI Gene PubMed Count 24
Grant Count 26
R01 Count 15
Funding $11,738,316.13
PubMed Score 13.68
PubTator Score 29.83

Knowledge Summary

Patent (10,917)

TINX Plot

  Disease Relevance (2)

Gene RIF (13)

PMID Text
26302849 The genotype "A/T" of rs12413624 in PRLHR gene was associated with a decreased risk of colorectal cancer.
26211894 Effects of systematic N-terminus deletions and benzoylations of endogenous RF-amide peptides on NPFF1R, NPFF2R, GPR10, GPR54 and GPR103.
23284171 demonstrate previously unrecognized roles for GPR10 and its upstream regulator REST in the pathogenesis of uterine fibroids
22778259 structural analysis of the human PrRP receptor (PrRPR) and the ligand-mimicking receptor variant of prolactin-releasing peptide
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
15752583 A ligand for The rat orphan receptor UHR-1.
14691196 Observational study of gene-disease association. (HuGE Navigator)
12716769 Observational study of gene-disease association. (HuGE Navigator)
12716769 There is an association of polymorphisms in this gene with blood pressure, but not obesity, in a U.K. Caucasian population.
More...

AA Sequence

MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLKGLIVLLYSVV      1 - 70
VVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAYAFEPRGWVFGGGLCHLVFFL     71 - 140
QPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAVLAIWALSAVLALPAAVHTYHVELKPHDVRL    141 - 210
CEEFWGSQERQRQLYAWGLLLVTYLLPLLVILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLL    211 - 280
VVIVVVFAVCWLPLHVFNLLRDLDPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLL    281 - 350
VAWPRKIAPHGQNMTVSVVI                                                      351 - 370
//

Text Mined References (24)

PMID Year Title
26302849 2015 Polymorphisms of PRLHR and HSPA12A and risk of gastric and colorectal cancer in the Chinese Han population.
26211894 2015 Effects of systematic N-terminus deletions and benzoylations of endogenous RF-amide peptides on NPFF1R, NPFF2R, GPR10, GPR54 and GPR103.
23284171 2013 Loss of the repressor REST in uterine fibroids promotes aberrant G protein-coupled receptor 10 expression and activates mammalian target of rapamycin pathway.
22778259 2012 Ligand-mimicking receptor variant discloses binding and activation mode of prolactin-releasing peptide.
22158540 2011 Genome-wide association study identifies five loci associated with susceptibility to pancreatic cancer in Chinese populations.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15885496 2005 Origin of the prolactin-releasing hormone (PRLH) receptors: evidence of coevolution between PRLH and a redundant neuropeptide Y receptor during vertebrate evolution.
15752583 2005 Characterization of a naturally-occurring polymorphism in the UHR-1 gene encoding the putative rat prolactin-releasing peptide receptor.
More...