Property Summary

Ligand Count 321
NCBI Gene PubMed Count 242
PubMed Score 849.12
PubTator Score 500.92

Knowledge Summary

Patent (65,086)

Expression

  Differential Expression (6)

Disease log2 FC p
tuberculosis -2.200 2.4e-08
psoriasis 1.400 2.7e-28
breast carcinoma 1.300 6.9e-04
cutaneous lupus erythematosus 1.800 1.3e-03
interstitial cystitis 1.500 2.6e-03
invasive ductal carcinoma 1.100 2.1e-02

Gene RIF (219)

AA Sequence

MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAFLPALYSLLFLLGLLG      1 - 70
NGAVAAVLLSRRTALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGAL     71 - 140
LLACISFDRYLNIVHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQV    141 - 210
GRTALRVLQLVAGFLLPLLVMAYCYAHILAVLLVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDIL    211 - 280
MDLGALARNCGRESRVDVAKSVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSS    281 - 350
SRRDSSWSETSEASYSGL                                                        351 - 368
//

Text Mined References (244)

PMID Year Title