Property Summary

NCBI Gene PubMed Count 219
Grant Count 460
R01 Count 261
Funding $48,324,924.9
PubMed Score 788.33
PubTator Score 500.92

Knowledge Summary

Patent (65,086)

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 1.800 0.001
tuberculosis -2.200 0.000
breast carcinoma 1.300 0.001
interstitial cystitis 1.500 0.003
invasive ductal carcinoma 1.100 0.021
psoriasis 1.400 0.000

Synonym

Accession P49682 B2R982 O15185 Q7Z710 Q9P2T4 Q9P2T5 CXC-R3
Symbols GPR9
MigR
CD182
CD183
Mig-R
CKR-L2
CMKAR3
IP10-R

Gene

  TechDev Info (1)

Gene RIF (198)

PMID Text
26831417 Both CXCL10 and CXCR3 appeared to be useful in differentiating T1R reaction in borderline leprosy while CXCR3 alone differentiated BT from BT-T1R
26823797 CXCR3 expression was upregulated in advanced gastric cancer and was associated with increased CD4+, CD8+ tumor-infiltrating lymphocyte infiltration and improved overall survival
26506526 congruent with the concept that inflammation plays a key role in the pathogenesis of LV dysfunction, MIG, IP10 and I-TAC add diagnostic accuracy over and beyond NT-pro BNP.
26434630 our study suggested a potential use of CXCR3 overexpression as a prognostic marker for gastric cancer
26394162 CXCR3 was also linked to steatosis through inducing hepatic lipogenic genes
26339376 Suggest that aberrant CXCR3 expression may play crucial roles in suppressing prostate carcinoma metastasis by inhibiting cell proliferation and invasion through the PCLbeta signaling pathway.
26209629 Results indicate that CXC chemokine receptors 3 (CXCR3) contributes to spontaneous preterm birth (SPTB).
26164305 This study is aimed at the optimization of a new analytical method for metabolic profiling with parallel bioaffinity assessment of CXCR3 ligands of the azaquinazolinone and piperazinyl-piperidine class and their metabolites.
26037167 The expression of the chemokine receptors CXCR3, CXCR4 and CXCR7 and their ligands.
25858769 Common variants of CXCR3 and its ligands CXCL10 and CXCL11 are associated with vascular permeability of dengue infection in peninsular Malaysia.
More...

AA Sequence

MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAFLPALYSLLFLLGLLG      1 - 70
NGAVAAVLLSRRTALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGAL     71 - 140
LLACISFDRYLNIVHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQV    141 - 210
GRTALRVLQLVAGFLLPLLVMAYCYAHILAVLLVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDIL    211 - 280
MDLGALARNCGRESRVDVAKSVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSS    281 - 350
SRRDSSWSETSEASYSGL                                                        351 - 368
//

Text Mined References (221)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26831417 2015 Is CXCL10/CXCR3 axis overexpression a better indicator of leprosy type 1 reaction than inducible nitric oxide synthase?
26823797 2015 Impact of chemokine receptor CXCR3 on tumor-infiltrating lymphocyte recruitment associated with favorable prognosis in advanced gastric cancer.
26506526 2015 Left Ventricular Dysfunction and CXCR3 Ligands in Hypertension: From Animal Experiments to a Population-Based Pilot Study.
26434630 2015 Overexpression of the chemokine receptor CXCR3 and its correlation with favorable prognosis in gastric cancer.
26394162 2016 CXC chemokine receptor 3 promotes steatohepatitis in mice through mediating inflammatory cytokines, macrophages and autophagy.
26339376 2015 Potential role of CXCR3 in proliferation and invasion of prostate cancer cells.
26209629 2015 CXCR3 Polymorphism and Expression Associate with Spontaneous Preterm Birth.
26164305 2015 Metabolic profiling of ligands for the chemokine receptor CXCR3 by liquid chromatography-mass spectrometry coupled to bioaffinity assessment.
26037167 2015 Expression of the Chemokine Receptors CXCR3, CXCR4, CXCR7 and Their Ligands in Rhabdomyosarcoma.
More...