Property Summary

NCBI Gene PubMed Count 116
Grant Count 182
R01 Count 116
Funding $13,239,046.97
PubMed Score 708.82
PubTator Score 855.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -1.400 0.001
astrocytic glioma -2.000 0.011
ependymoma -2.100 0.019
oligodendroglioma -1.700 0.023
cutaneous lupus erythematosus -1.900 0.001
osteosarcoma -1.827 0.000
glioblastoma -1.800 0.000
medulloblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -2.000 0.000
medulloblastoma, large-cell -1.900 0.001
pediatric high grade glioma -1.500 0.000
pilocytic astrocytoma -1.400 0.000
nasopharyngeal carcinoma 1.700 0.009
ovarian cancer -2.500 0.000
psoriasis -1.200 0.000

Synonym

Accession P49675 Q16396 StAR
Symbols STARD1

Gene

PANTHER Protein Class (1)

PDB

1IMG   2I93   3P0L  

 GWAS Trait (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
504933 confirmatory 2 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based cell-based assay to identify inhibitors of Star (Steroidogenic acute regulatory protein)

Gene RIF (87)

PMID Text
26271515 Current level of understanding on tissue-specific and hormone-induced regulation of STAR expression and steroidogenesis, and insights into a number of cholesterol and/or steroid coupled physiological consequences.[review]
26014698 amino acid of mutant position of the novel p.E123K was highly conserved in ten different species and was predicted to have impacts on the structure and function of StAR protein by the PolyPhen-2 prediction software
26001835 activins A, B and AB down-regulate StAR expression and decrease progesterone production in human granulosa cells, likely via an ALK4-mediated SMAD2/SMAD4-dependent pathway.
25002576 Mutagenesis confirmed that Arg(312) and Arg(313) are crucial for this mode of regulation, and novel interactions with the START domain
25001622 Hypoxia in pulmonary artery endothelial cells results in upregulation of STAR protein.
24422629 StAR proteolysis is executed by at least 2 mitochondrial proteases, the matrix LON protease and the inner membrane complexes of the metalloproteases AFG3L2 and AFG3L2:SPG7/paraplegin.
24140593 BMP15 down-regulates StAR expression and decreases progesterone production in human granulosa cells, likely via ALK3-mediated SMAD1/5/8 signaling.
24053410 Cholesterol-mediated conformational changes in StAR are essential for steroidogenesis.
23920000 The novel mutation p.Trp147Arg of the steroidogenic acute regulatory protein causes classic lipoid congenital adrenal hyperplasia with adrenal insufficiency and 46,XY disorder of sex development.
23825130 Expression of StAR and P45011beta (cytochrome P450 family 11 subfamily B polypeptide 1) is down-regulated in adrenocortical cells and neurons under oxidative stress by ALADIN (triple A syndrome protein, human) knockdown.
More...

AA Sequence

MLLATFKLCAGSSYRHMRNMKGLRQQAVMAISQELNRRALGGPTPSTWINQVRRRSSLLGSRLEETLYSD      1 - 70
QELAYLQQGEEAMQKALGILSNQEGWKKESQQDNGDKVMSKVVPDVGKVFRLEVVVDQPMERLYEELVER     71 - 140
MEAMGEWNPNVKEIKVLQKIGKDTFITHELAAEAAGNLVGPRDFVSVRCAKRRGSTCVLAGMATDFGNMP    141 - 210
EQKGVIRAEHGPTCMVLHPLAGSPSKTKLTWLLSIDLKGWLPKSIINQVLSQTQVDFANHLRKRLESHPA    211 - 280
SEARC                                                                     281 - 285
//

Text Mined References (118)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26271515 2016 Role of the steroidogenic acute regulatory protein in health and disease.
26014698 2015 [Clinical features and StAR gene mutations in children with congenital lipoid adrenal hyperplasia].
26001835 2015 Activin A, B and AB decrease progesterone production by down-regulating StAR in human granulosa cells.
25416956 2014 A proteome-scale map of the human interactome network.
25002576 2014 Structural basis for regulation of the human acetyl-CoA thioesterase 12 and interactions with the steroidogenic acute regulatory protein-related lipid transfer (START) domain.
25001622 2014 Upregulation of steroidogenic acute regulatory protein by hypoxia stimulates aldosterone synthesis in pulmonary artery endothelial cells to promote pulmonary vascular fibrosis.
24422629 2014 StAR enhances transcription of genes encoding the mitochondrial proteases involved in its own degradation.
24140593 2013 BMP15 suppresses progesterone production by down-regulating StAR via ALK3 in human granulosa cells.
24124408 2013 Genome-wide association study of orthostatic hypotension and supine-standing blood pressure changes in two korean populations.
More...