Property Summary

NCBI Gene PubMed Count 122
PubMed Score 738.36
PubTator Score 855.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.200 1.6e-02
astrocytic glioma -2.000 1.1e-02
Astrocytoma, Pilocytic -1.400 2.7e-05
atypical teratoid / rhabdoid tumor -2.000 3.7e-09
cutaneous lupus erythematosus -1.900 6.7e-04
ependymoma -2.100 1.9e-02
glioblastoma -1.300 2.4e-06
group 3 medulloblastoma -1.100 4.8e-02
malignant mesothelioma -1.400 5.5e-04
medulloblastoma, large-cell -1.900 6.9e-04
nasopharyngeal carcinoma 1.700 8.9e-03
oligodendroglioma -1.700 2.3e-02
osteosarcoma -1.827 1.8e-06
ovarian cancer -2.500 5.7e-09
psoriasis -1.200 3.4e-60

 GWAS Trait (1)

Gene RIF (92)

AA Sequence

MLLATFKLCAGSSYRHMRNMKGLRQQAVMAISQELNRRALGGPTPSTWINQVRRRSSLLGSRLEETLYSD      1 - 70
QELAYLQQGEEAMQKALGILSNQEGWKKESQQDNGDKVMSKVVPDVGKVFRLEVVVDQPMERLYEELVER     71 - 140
MEAMGEWNPNVKEIKVLQKIGKDTFITHELAAEAAGNLVGPRDFVSVRCAKRRGSTCVLAGMATDFGNMP    141 - 210
EQKGVIRAEHGPTCMVLHPLAGSPSKTKLTWLLSIDLKGWLPKSIINQVLSQTQVDFANHLRKRLESHPA    211 - 280
SEARC                                                                     281 - 285
//

Text Mined References (124)

PMID Year Title