Property Summary

NCBI Gene PubMed Count 116
Grant Count 32
R01 Count 21
Funding $4,175,186.34
PubMed Score 60.74
PubTator Score 48.60

Knowledge Summary

Patent (5,186)

Expression

  Differential Expression (11)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.343 0.001
Chronic Lymphocytic Leukemia 1.212 0.000
malignant mesothelioma -2.100 0.000
oligodendroglioma 1.400 0.015
psoriasis 1.700 0.001
osteosarcoma 1.223 0.006
sonic hedgehog group medulloblastoma 1.700 0.000
pancreatic ductal adenocarcinoma liver m... 1.054 0.013
spina bifida -2.185 0.029
ovarian cancer 1.900 0.000
pancreatic cancer -1.200 0.008

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (69)

PMID Text
26928339 Findings establish CK1varepsilon as a regulator of antiviral innate immune responses and indicate a novel mechanism of immunoregulation that involves CK1varepsilon-mediated phosphorylation of TRAF3.
26327509 CSNK1E expression is associated with disease-free survival in breast cancer patients with wild-type p53 or poor histological differentiation or in those without adjuvant chemotherapy.
26283580 a 4-locus CSNK1E haplotype encompassing the rs1534891 SNP (Z-score=2.685, permuted p=0.0076) and a 3-locus haplotype in ARNTL (Z-score=3.269, permuted p=0.0011) showed a significant association with Bipolar Disorder
26122218 CK1epsilon expression was higher in colorectal cancer tissues vs normal and was correlated with the Dukes staging and depth of invasion. Knockdown reduced cell proliferation and invasion and downregulated wnt3alpha, beta-catenin, PCNA and MMP-9.
25724478 site-specific phosphorylation of adiponectin, especially at sites targeted by CK1delta in vitro, provides an additional regulatory mechanism for modulating adiponectin complex formation and function.
25665722 The dynamical and conformational properties for each of three isoforms of CK1 are explored through molecular dynamics (MD) simulations.
25521358 The results support our previous report of association of CSNK1E SNP rs1534891 with protection from heroin addiction. CSNK1E interacts with circadian rhythms and DARPP-32 and has been implicated in negative regulation of sensitivity to opioids in rodents.
25404202 Results indicate that changes in the expression levels of casein kinase 1 isoforms CK1delta and DK1epsilon in colorectal tumors correlate with patients' survival.
24947187 we validated the top two synthetic lethal gene pairs, CSNK1E-TP53 and CTNNB1-TP53, in colorectal cancer
24557581 The loss of cytoplasmic CK1epsilon expression is greatly associated with poor survival and might be an adverse survival factor.
More...

AA Sequence

MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIPSIKW      1 - 70
CGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGK     71 - 140
KGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGS    141 - 210
LPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQ    211 - 280
GFSYDYVFDWNMLKFGAARNPEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVAS    281 - 350
TPASRIQPAGNTSPRAISRVDRERKVSMRLHRGAPANVSSSDLTGRQEVSRIPASQTSVPFDHLGK        351 - 416
//

Text Mined References (129)

PMID Year Title
26928339 2016 The kinase CK1? controls the antiviral immune response by phosphorylating the signaling adaptor TRAF3.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26327509 2015 High casein kinase 1 epsilon levels are correlated with better prognosis in subsets of patients with breast cancer.
26283580 2015 Identification of circadian gene variants in bipolar disorder in Latino populations.
26122218 KNOCKDOWN OF CASEIN KINASE 1e INHIBITS CELL PROLIFERATION AND INVASION OF COLORECTAL CANCER CELLS VIA INHIBITION OF THE Wnt/?-CATENIN SIGNALING.
25724478 2015 Gene expression levels of Casein kinase 1 (CK1) isoforms are correlated to adiponectin levels in adipose tissue of morbid obese patients and site-specific phosphorylation mediated by CK1 influences multimerization of adiponectin.
25665722 2015 A comparative study of structural and conformational properties of casein kinase-1 isoforms: insights from molecular dynamics and principal component analysis.
25521358 2014 Dopaminergic pathway polymorphisms and heroin addiction: further support for association of CSNK1E variants.
25500533 2014 Phosphorylation of LRRK2 by casein kinase 1? regulates trans-Golgi clustering via differential interaction with ARHGEF7.
25416956 2014 A proteome-scale map of the human interactome network.
More...