Property Summary

NCBI Gene PubMed Count 63
Grant Count 44
R01 Count 28
Funding $4,734,639.21
PubMed Score 137.52
PubTator Score 143.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
hepatocellular carcinoma 1.400 0.000
Multiple myeloma 1.066 0.025
malignant mesothelioma 1.100 0.000
osteosarcoma -1.662 0.000
cystic fibrosis 1.440 0.000
glioblastoma 1.700 0.000
non-small cell lung cancer -1.170 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.033
lung cancer -3.700 0.000
subependymal giant cell astrocytoma 1.658 0.039
lung carcinoma -2.400 0.000
ulcerative colitis 1.600 0.000
ovarian cancer -2.000 0.000
pituitary cancer -1.400 0.000
psoriasis 1.100 0.000

Gene RIF (41)

PMID Text
27003256 apoptosis is induced by rhein traditional Chinese medicine via induction of endoplasmic reticulum stress, caspase-4 and intracellular calcium in primary human hepatic HL-7702 cells
26508369 Caspase-4 and caspase-5 mediate IL-1alpha and IL-1beta release from human monocytes after lipopolysaccharides stimulation.
26174085 caspase-4 activation alone is sufficient to induce pyroptosis, this process depends on the NLRP3 inflammasome activation to drive IL-1beta maturation.
26173988 both caspase-4 and caspase-5 are functionally important for appropriate responses to intracellular Gram-negative bacteria.
25964352 implicate caspase-4 as a critical regulator of noncanonical inflammasome activation that initiates defense against bacterial pathogens in primary macrophages
25943872 this study has identified epithelial-expressed caspases-4 and -5 as biomarkers with diagnostic and therapeutic potential in colorectal cancer.
25695505 NF-kappaB can mediate Fas-induced apoptosis through caspase-4 protease
25487697 This study reveled that CASP4 having a central role in the bipolar disease and schizophrenia manifestation.
25121752 The caspase-4/11 inflammasome also governs activation of the proinflammatory cytokine, interleukin (IL)-18, in response to intracellular and extracellular enteric pathogens.
25119034 function of caspase-4/5/11 represents a new mode of pattern recognition in immunity and also an unprecedented means of caspase activation
More...

AA Sequence

MAEGNHRKKPLKVLESLGKDFLTGVLDNLVEQNVLNWKEEEKKKYYDAKTEDKVRVMADSMQEKQRMAGQ      1 - 70
MLLQTFFNIDQISPNKKAHPNMEAGPPESGESTDALKLCPHEEFLRLCKERAEEIYPIKERNNRTRLALI     71 - 140
ICNTEFDHLPPRNGADFDITGMKELLEGLDYSVDVEENLTARDMESALRAFATRPEHKSSDSTFLVLMSH    141 - 210
GILEGICGTVHDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASS    211 - 280
QSSENLEEDAVYKTHVEKDFIAFCSSTPHNVSWRDSTMGSIFITQLITCFQKYSWCCHLEEVFRKVQQSF    281 - 350
ETPRAKAQMPTIERLSMTRYFYLFPGN                                               351 - 377
//

Text Mined References (73)

PMID Year Title
27003256 2016 Rhein triggers apoptosis via induction of endoplasmic reticulum stress, caspase-4 and intracellular calcium in primary human hepatic HL-7702 cells.
26508369 2015 Human caspase-4 and caspase-5 regulate the one-step non-canonical inflammasome activation in monocytes.
26375003 2015 Cleavage of GSDMD by inflammatory caspases determines pyroptotic cell death.
26174085 2015 Caspase-4 mediates non-canonical activation of the NLRP3 inflammasome in human myeloid cells.
26173988 2015 NLRP3 inflammasome activation downstream of cytoplasmic LPS recognition by both caspase-4 and caspase-5.
25964352 2015 Human caspase-4 mediates noncanonical inflammasome activation against gram-negative bacterial pathogens.
25943872 2015 Altered expression of caspases-4 and -5 during inflammatory bowel disease and colorectal cancer: Diagnostic and therapeutic potential.
25695505 2015 NF-?B regulates caspase-4 expression and sensitizes neuroblastoma cells to Fas-induced apoptosis.
25487697 2015 Innate immune response is differentially dysregulated between bipolar disease and schizophrenia.
25121752 2014 Noncanonical inflammasome activation of caspase-4/caspase-11 mediates epithelial defenses against enteric bacterial pathogens.
More...