Property Summary

NCBI Gene PubMed Count 27
PubMed Score 0.00
PubTator Score 18.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Synonym

Accession P49643 Q53FJ8 Q6P1Q7 Q8WVL2 Q9H413
Symbols p58
PRIM2A

Gene

PDB

3L9Q   3Q36   4BPU   4BPW   4BPX   4RR2   5DQO   5EXR   5F0Q   5F0S  

Gene RIF (8)

PMID Text
26710848 Data suggest that PRIM1-p58,C-terminal domain stays bound to initiating NTP and 3prime-overhang DNA during whole cycle of RNA primer synthesis; meanwhile, PRIM1-p49 slides along DNA template toward 5prime-end with PRIM1-p58,N-terminal domain attached.
25550159 Data indicate that the conformational changes in primase are necessary to accomplish the initiation and then elongation of RNA synthesis.
24962573 the N-terminal domain of the large subunit of primase (p58N) directly interacts with the C-terminal domain of the catalytic subunit of polalpha (p180C)
22437878 PRIM2 gene is not imprinted in the placenta.
21346410 The fragment that forms a beta-sheet in the reported structure p58C/3L9Q of the same human primase domain is folded in three alpha-helices in our p58C/3Q36 structure, similarly to yeast primase.
20643958 p58C(C-terminal regulatory domain of the large subunit) structure reveals a novel arrangement of an evolutionarily conserved 4Fe-4S cluster buried deeply within the protein core and is not similar to any known protein structure.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17893144 analysis of the iron-sulfur cluster in the C-terminal domain of the p58 subunit of human DNA primase

AA Sequence

MEFSGRKWRKLRLAGDQRNASYPHCLQFYLQPPSENISLIEFENLAIDRVKLLKSVENLGVSYVKGTEQY      1 - 70
QSKLESELRKLKFSYRENLEDEYEPRRRDHISHFILRLAYCQSEELRRWFIQQEMDLLRFRFSILPKDKI     71 - 140
QDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGFESIYKIPFADALDLFRGRKVYLEDGFAYVP    141 - 210
LKDIVAIILNEFRAKLSKALALTARSLPAVQSDERLQPLLNHLSHSYTGQDYSTQGNVGKISLDQIDLLS    211 - 280
TKSFPPCMRQLHKALRENHHLRHGGRMQYGLFLKGIGLTLEQALQFWKQEFIKGKMDPDKFDKGYSYNIR    281 - 350
HSFGKEGKRTDYTPFSCLKIILSNPPSQGDYHGCPFRHSDPELLKQKLQSYKISPGGISQILDLVKGTHY    351 - 420
QVACQKYFEMIHNVDDCGFSLNHPNQFFCESQRILNGGKDIKKEPIQPETPQPKPSVQKTKDASSALASL    421 - 490
NSSLEMDMEGLEDYFSEDS                                                       491 - 509
//

Text Mined References (33)

PMID Year Title
26710848 2016 Insight into the Human DNA Primase Interaction with Template-Primer.
25550159 2015 Crystal structure of the human primase.
24962573 2014 The C-terminal domain of the DNA polymerase catalytic subunit regulates the primase and polymerase activities of the human DNA polymerase ?-primase complex.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22437878 2012 Lack of genomic imprinting of DNA primase, polypeptide 2 (PRIM2) in human term placenta and white blood cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21346410 2011 Crystal structure of the C-terminal domain of human DNA primase large subunit: implications for the mechanism of the primase-polymerase ? switch.
21269460 2011 Initial characterization of the human central proteome.
20675616 2010 The genomic distribution and local context of coincident SNPs in human and chimpanzee.
More...