Property Summary

NCBI Gene PubMed Count 27
PubMed Score 0.00
PubTator Score 18.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma 1.200 1.4e-04
atypical teratoid / rhabdoid tumor 1.400 8.7e-07
Gaucher disease type 1 -1.100 3.9e-02
glioblastoma 1.300 9.7e-07
group 3 medulloblastoma 1.600 2.5e-04
lung adenocarcinoma 1.300 3.6e-05
lung cancer 1.400 1.0e-02
medulloblastoma, large-cell 2.000 8.3e-06
non-small cell lung cancer 1.273 6.4e-16
osteosarcoma 2.630 1.3e-02
posterior fossa group A ependymoma 1.100 9.3e-05
primitive neuroectodermal tumor 1.400 4.1e-06
psoriasis -1.400 9.6e-04

PDB (11)

Gene RIF (8)

AA Sequence

MEFSGRKWRKLRLAGDQRNASYPHCLQFYLQPPSENISLIEFENLAIDRVKLLKSVENLGVSYVKGTEQY      1 - 70
QSKLESELRKLKFSYRENLEDEYEPRRRDHISHFILRLAYCQSEELRRWFIQQEMDLLRFRFSILPKDKI     71 - 140
QDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGFESIYKIPFADALDLFRGRKVYLEDGFAYVP    141 - 210
LKDIVAIILNEFRAKLSKALALTARSLPAVQSDERLQPLLNHLSHSYTGQDYSTQGNVGKISLDQIDLLS    211 - 280
TKSFPPCMRQLHKALRENHHLRHGGRMQYGLFLKGIGLTLEQALQFWKQEFIKGKMDPDKFDKGYSYNIR    281 - 350
HSFGKEGKRTDYTPFSCLKIILSNPPSQGDYHGCPFRHSDPELLKQKLQSYKISPGGISQILDLVKGTHY    351 - 420
QVACQKYFEMIHNVDDCGFSLNHPNQFFCESQRILNGGKDIKKEPIQPETPQPKPSVQKTKDASSALASL    421 - 490
NSSLEMDMEGLEDYFSEDS                                                       491 - 509
//

Text Mined References (33)

PMID Year Title