Property Summary

NCBI Gene PubMed Count 19
PubMed Score 8.05
PubTator Score 51.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Synonym

Accession P49642
Symbols p49

Gene

PDB

4BPU   4BPW   4BPX   4RR2   5EXR   4LIK   4LIL   4MHQ  

 GWAS Trait (1)

Gene RIF (4)

PMID Text
26710848 Data suggest that PRIM1-p58,C-terminal domain stays bound to initiating NTP and 3prime-overhang DNA during whole cycle of RNA primer synthesis; meanwhile, PRIM1-p49 slides along DNA template toward 5prime-end with PRIM1-p58,N-terminal domain attached.
25550159 Data indicate that the conformational changes in primase are necessary to accomplish the initiation and then elongation of RNA synthesis.
22593576 Findings indicate that tethering of DNA primase Prim1 to the replisome by DNA polymerase alpha (pol alpha) is critical for the normal action of DNA replication forks in eukaryotic cells.
20030400 Mechanisms by which human DNA primase chooses to polymerize a nucleoside triphosphate

AA Sequence

METFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEM      1 - 70
QKMNPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIR     71 - 140
IIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHP    141 - 210
FIRKSINIIKKYFEEYALVNQDILENKESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQ    211 - 280
NNIKNDKYGPWLEWEIMLQYCFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTI    281 - 350
SFICRELDAISTNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEHFLENLDKSRKGELLKKSDLQKDF    351 - 420
//

Text Mined References (22)

PMID Year Title
26710848 2016 Insight into the Human DNA Primase Interaction with Template-Primer.
25550159 2015 Crystal structure of the human primase.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22593576 2012 A conserved motif in the C-terminal tail of DNA polymerase ? tethers primase to the eukaryotic replisome.
22267201 2012 Meta-analyses identify 13 loci associated with age at menopause and highlight DNA repair and immune pathways.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20030400 2010 Mechanisms by which human DNA primase chooses to polymerize a nucleoside triphosphate.
19946888 2010 Defining the membrane proteome of NK cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...