Property Summary

NCBI Gene PubMed Count 20
PubMed Score 7.80
PubTator Score 51.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma 1.386 2.4e-04
colon cancer 1.400 2.8e-02
glioblastoma 1.200 6.3e-06
group 3 medulloblastoma 2.800 5.9e-07
lung cancer 1.700 4.9e-02
malignant mesothelioma 2.500 1.0e-08
medulloblastoma, large-cell 1.700 3.1e-05
non-small cell lung cancer 1.343 2.9e-14
pediatric high grade glioma 1.100 1.0e-03
primary Sjogren syndrome 1.100 3.2e-04
primitive neuroectodermal tumor 1.700 2.7e-04
Waldenstrons macroglobulinemia 1.285 1.9e-02

Protein-protein Interaction (3)

Gene RIF (5)

AA Sequence

METFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEM      1 - 70
QKMNPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIR     71 - 140
IIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHP    141 - 210
FIRKSINIIKKYFEEYALVNQDILENKESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQ    211 - 280
NNIKNDKYGPWLEWEIMLQYCFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTI    281 - 350
SFICRELDAISTNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEHFLENLDKSRKGELLKKSDLQKDF    351 - 420
//

Text Mined References (23)

PMID Year Title