Property Summary

NCBI Gene PubMed Count 9
PubMed Score 25.29
PubTator Score 12.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 1.2e-07
osteosarcoma 7950 1.8e-05
Disease Target Count Z-score Confidence
Congestive heart failure 113 0.0 0.9
Disease Target Count Z-score Confidence
hand-foot-genital syndrome 9 3.912 2.0
Cervical incompetence 6 3.888 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.093 1.8e-05
ovarian cancer -1.500 1.2e-07

Gene RIF (2)

AA Sequence

MESRKDMVVFLDGGQLGTLVGKRVSNLSEAVGSPLPEPPEKMVPRGCLSPRAVPPATRERGGGGPEEEPV      1 - 70
DGLAGSAAGPGAEPQVAGAAMLGPGPPAPSVDSLSGQGQPSSSDTESDFYEEIEVSCTPDCATGNAEYQH     71 - 140
SKGSGSEALVGSPNGGSETPKSNGGSGGGGSQGTLACSASDQMRRYRTAFTREQIARLEKEFYRENYVSR    141 - 210
PRRCELAAALNLPETTIKVWFQNRRMKDKRQRLAMTWPHPADPAFYTYMMSHAAAAGGLPYPFPSHLPLP    211 - 280
YYSPVGLGAASAASAAASPFSGSLRPLDTFRVLSQPYPRPELLCAFRHPPLYPGPAHGLGASAGGPCSCL    281 - 350
ACHSGPANGLAPRAAAASDFTCASTSRSDSFLTFAPSVLSKASSVALDQREEVPLTR                 351 - 407
//

Text Mined References (10)

PMID Year Title