Property Summary

NCBI Gene PubMed Count 35
PubMed Score 247.45
PubTator Score 96.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
lung cancer 4740 7.0e-06
pancreatic ductal adenocarcinoma liver metastasis 1962 1.8e-02
colon cancer 1478 4.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Familial isolated deficiency of vitamin E 6 7.296 3.6

Expression

  Differential Expression (3)

Disease log2 FC p
colon cancer -1.500 4.9e-02
lung cancer 4.000 7.0e-06
pancreatic ductal adenocarcinoma liver m... -1.388 1.8e-02

Gene RIF (22)

AA Sequence

MAEARSQPSAGPQLNALPDHSPLLQPGLAALRRRAREAGVPLAPLPLTDSFLLRFLRARDFDLDLAWRLL      1 - 70
KNYYKWRAECPEISADLHPRSIIGLLKAGYHGVLRSRDPTGSKVLIYRIAHWDPKVFTAYDVFRVSLITS     71 - 140
ELIVQEVETQRNGIKAIFDLEGWQFSHAFQITPSVAKKIAAVLTDSFPLKVRGIHLINEPVIFHAVFSMI    141 - 210
KPFLTEKIKERIHMHGNNYKQSLLQHFPDILPLEYGGEEFSMEDICQEWTNFIMKSEDYLSSISESIQ      211 - 278
//

Text Mined References (34)

PMID Year Title