Property Summary

NCBI Gene PubMed Count 33
Grant Count 52
R01 Count 28
Funding $9,070,900.63
PubMed Score 240.42
PubTator Score 96.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.388 0.018
colon cancer -1.500 0.049
lung cancer 4.000 0.000

Gene RIF (20)

PMID Text
23599266 The crystal structure of the alpha-TTP-phosphatidylinositol phosphates (PIPs) complex revealed that the familial vitamin E deficiency-related arginine residues interacted with phosphate groups of the PIPs and that the PIPs binding caused the lid of the alpha-tocopherol-binding pocket to open.
23079030 Single-nucleotide polymorphisms that are commonly found in healthy humans dramatically affect promoter activity of the TTPA gene.
22752767 study demonstrated that alpha -TTP can be upregulated in case of oxidative stress in BeWo trophoblast cells; speculate that possibly, alpha -TTP is notonly involved in normal pregnancy, but also in cases of pregnancy disorders with intense oxidative stress
21110980 Substitution of residues in helices A8 (F165A and F169A) and A10 (I202A, V206A and M209A) decreased the rate of intermembrane ligand transfer as well as protein adsorption to phospholipid bilayers.
20826775 Data show that reduction ("knockdown") of tocopherol transfer protein (TTP) expression resulted in resistance to the vitamin E.
20801516 Observational study of genetic testing. (HuGE Navigator)
19458973 Hydrophobic features of alpha-TTP dominating the binding energy between protein and membrane.
19190344 Genetic variation in TTPA and SEC14L2 is associated with serum alpha-tocopherol but does not have a direct effect on prostate cancer when vitamin E is administered.
19190344 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19102053 Total deletion of the TTPA gene is expected to be associated with severe phenotype in AVED patients.
More...

AA Sequence

MAEARSQPSAGPQLNALPDHSPLLQPGLAALRRRAREAGVPLAPLPLTDSFLLRFLRARDFDLDLAWRLL      1 - 70
KNYYKWRAECPEISADLHPRSIIGLLKAGYHGVLRSRDPTGSKVLIYRIAHWDPKVFTAYDVFRVSLITS     71 - 140
ELIVQEVETQRNGIKAIFDLEGWQFSHAFQITPSVAKKIAAVLTDSFPLKVRGIHLINEPVIFHAVFSMI    141 - 210
KPFLTEKIKERIHMHGNNYKQSLLQHFPDILPLEYGGEEFSMEDICQEWTNFIMKSEDYLSSISESIQ      211 - 278
//

Text Mined References (32)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23599266 2013 Impaired ?-TTP-PIPs interaction underlies familial vitamin E deficiency.
23079030 2012 Expression of the ?-tocopherol transfer protein gene is regulated by oxidative stress and common single-nucleotide polymorphisms.
22752767 2012 Oxidative stress stimulates ?-tocopherol transfer protein in human trophoblast tumor cells BeWo.
21110980 2011 The contribution of surface residues to membrane binding and ligand transfer by the ?-tocopherol transfer protein (?-TTP).
20826775 2010 Tocopherol transfer protein sensitizes prostate cancer cells to vitamin E.
20801516 2011 Simultaneous mutation detection in 90 retinal disease genes in multiple patients using a custom-designed 300-kb retinal resequencing chip.
19458973 2009 Effect of bilayer phospholipid composition and curvature on ligand transfer by the alpha-tocopherol transfer protein.
19190344 2009 Association of variants in two vitamin e transport genes with circulating vitamin e concentrations and prostate cancer risk.
More...