Property Summary

NCBI Gene PubMed Count 24
PubMed Score 18.81
PubTator Score 12.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.84881859872846E-19
malignant mesothelioma 3163 1.11525904478905E-4
ependymoma 2514 1.14063873991394E-4
atypical teratoid/rhabdoid tumor 1095 1.18765790483275E-4
osteosarcoma 7933 2.98786922084935E-4
sonic hedgehog group medulloblastoma 1482 0.00550380514816808
subependymal giant cell astrocytoma 2287 0.0181928728003078
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 2.200 0.000
osteosarcoma -1.761 0.000
ependymoma -1.200 0.000
atypical teratoid/rhabdoid tumor -1.400 0.000
sonic hedgehog group medulloblastoma -1.400 0.006
subependymal giant cell astrocytoma -1.920 0.018
lung carcinoma 1.800 0.000

Synonym

Accession P49619 B2RAH4 Q2M1H4 Q5FWG1 DAG kinase gamma
Symbols DAGK3
DGK-GAMMA

Gene

PANTHER Protein Class (2)

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid

Gene RIF (7)

PMID Text
24486543 these results indicate that DGKG is an anionic phospholipid binding protein that preferably interacts with a small highly charged head group that is very close to the glycerol or sphingosine backbone.
20816195 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20215397 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20200978 Observational study of gene-disease association. (HuGE Navigator)
17803461 the interaction of diacylglycerol kinase gamma with the Src homology 2 and C1 domains of beta2-chimaerin is induced synergistically by Phorbol ester and hydrogen peroxide
12732202 diacylglycerol kinase gamma regulates macrophage differentiation.

AA Sequence

MGEERWVSLTPEEFDQLQKYSEYSSKKIKDALTEFNEGGSLKQYDPHEPISYDVFKLFMRAYLEVDLPQP      1 - 70
LSTHLFLAFSQKPRHETSDHPTEGASNSEANSADTNIQNADNATKADEACAPDTESNMAEKQAPAEDQVA     71 - 140
ATPLEPPVPRSSSSESPVVYLKDVVCYLSLLETGRPQDKLEFMFRLYDSDENGLLDQAEMDCIVNQMLHI    141 - 210
AQYLEWDPTELRPILKEMLQGMDYDRDGFVSLQEWVHGGMTTIPLLVLLGMDDSGSKGDGRHAWTMKHFK    211 - 280
KPTYCNFCHIMLMGVRKQGLCCTYCKYTVHERCVSRNIPGCVKTYSKAKRSGEVMQHAWVEGNSSVKCDR    281 - 350
CHKSIKCYQSVTARHCVWCRMTFHRKCELSTLCDGGELRDHILLPTSICPITRDRPGEKSDGCVSAKGEL    351 - 420
VMQYKIIPTPGTHPLLVLVNPKSGGRQGERILRKFHYLLNPKQVFNLDNGGPTPGLNFFRDTPDFRVLAC    421 - 490
GGDGTVGWILDCIDKANFAKHPPVAVLPLGTGNDLARCLRWGGGYEGGSLTKILKDIEQSPLVMLDRWHL    491 - 560
EVIPREEVENGDQVPYSIMNNYFSIGVDASIAHRFHVMREKHPEKFNSRMKNKLWYFEFGTSETFAATCK    561 - 630
KLHDHIELECDGVGVDLSNIFLEGIAILNIPSMYGGTNLWGENKKNRAVIRESRKGVTDPKELKFCVQDL    631 - 700
SDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCASVTIRTNKLLPMQVDGEPWMQPCCTIKITHKNQAPM    701 - 770
MMGPPQKSSFFSLRRKSRSKD                                                     771 - 791
//

Text Mined References (28)

PMID Year Title
24486543 2014 Diacylglycerol kinase ? is a novel anionic phospholipid binding protein with a selective binding preference.
22627129 2012 Biosynthesis of alkyl lysophosphatidic acid by diacylglycerol kinases.
20816195 2010 Analyses of shared genetic factors between asthma and obesity in children.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20215397 2010 Implication of genetic variants near NEGR1, SEC16B, TMEM18, ETV5/DGKG, GNPDA2, LIN7C/BDNF, MTCH2, BCDIN3D/FAIM2, SH2B1, FTO, MC4R, and KCTD15 with obesity and type 2 diabetes in 7705 Chinese.
20200978 2010 Replication of previous genome-wide association studies of bone mineral density in premenopausal American women.
19079260 2009 Genome-wide association yields new sequence variants at seven loci that associate with measures of obesity.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17803461 2008 Phorbol ester and hydrogen peroxide synergistically induce the interaction of diacylglycerol kinase gamma with the Src homology 2 and C1 domains of beta2-chimaerin.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
More...