Property Summary

NCBI Gene PubMed Count 24
PubMed Score 18.81
PubTator Score 12.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 2.200 0.000
osteosarcoma -1.761 0.000
ependymoma -1.200 0.000
atypical teratoid/rhabdoid tumor -1.400 0.000
sonic hedgehog group medulloblastoma -1.400 0.006
subependymal giant cell astrocytoma -1.920 0.018
lung carcinoma 1.800 0.000

Synonym

Accession P49619 B2RAH4 Q2M1H4 Q5FWG1 DAG kinase gamma
Symbols DAGK3
DGK-GAMMA

Gene

PANTHER Protein Class (2)

Gene RIF (7)

PMID Text
24486543 these results indicate that DGKG is an anionic phospholipid binding protein that preferably interacts with a small highly charged head group that is very close to the glycerol or sphingosine backbone.
20816195 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20215397 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20200978 Observational study of gene-disease association. (HuGE Navigator)
17803461 the interaction of diacylglycerol kinase gamma with the Src homology 2 and C1 domains of beta2-chimaerin is induced synergistically by Phorbol ester and hydrogen peroxide
12732202 diacylglycerol kinase gamma regulates macrophage differentiation.

AA Sequence

MGEERWVSLTPEEFDQLQKYSEYSSKKIKDALTEFNEGGSLKQYDPHEPISYDVFKLFMRAYLEVDLPQP      1 - 70
LSTHLFLAFSQKPRHETSDHPTEGASNSEANSADTNIQNADNATKADEACAPDTESNMAEKQAPAEDQVA     71 - 140
ATPLEPPVPRSSSSESPVVYLKDVVCYLSLLETGRPQDKLEFMFRLYDSDENGLLDQAEMDCIVNQMLHI    141 - 210
AQYLEWDPTELRPILKEMLQGMDYDRDGFVSLQEWVHGGMTTIPLLVLLGMDDSGSKGDGRHAWTMKHFK    211 - 280
KPTYCNFCHIMLMGVRKQGLCCTYCKYTVHERCVSRNIPGCVKTYSKAKRSGEVMQHAWVEGNSSVKCDR    281 - 350
CHKSIKCYQSVTARHCVWCRMTFHRKCELSTLCDGGELRDHILLPTSICPITRDRPGEKSDGCVSAKGEL    351 - 420
VMQYKIIPTPGTHPLLVLVNPKSGGRQGERILRKFHYLLNPKQVFNLDNGGPTPGLNFFRDTPDFRVLAC    421 - 490
GGDGTVGWILDCIDKANFAKHPPVAVLPLGTGNDLARCLRWGGGYEGGSLTKILKDIEQSPLVMLDRWHL    491 - 560
EVIPREEVENGDQVPYSIMNNYFSIGVDASIAHRFHVMREKHPEKFNSRMKNKLWYFEFGTSETFAATCK    561 - 630
KLHDHIELECDGVGVDLSNIFLEGIAILNIPSMYGGTNLWGENKKNRAVIRESRKGVTDPKELKFCVQDL    631 - 700
SDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCASVTIRTNKLLPMQVDGEPWMQPCCTIKITHKNQAPM    701 - 770
MMGPPQKSSFFSLRRKSRSKD                                                     771 - 791
//

Text Mined References (28)

PMID Year Title
24486543 2014 Diacylglycerol kinase ? is a novel anionic phospholipid binding protein with a selective binding preference.
22627129 2012 Biosynthesis of alkyl lysophosphatidic acid by diacylglycerol kinases.
20816195 2010 Analyses of shared genetic factors between asthma and obesity in children.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20215397 2010 Implication of genetic variants near NEGR1, SEC16B, TMEM18, ETV5/DGKG, GNPDA2, LIN7C/BDNF, MTCH2, BCDIN3D/FAIM2, SH2B1, FTO, MC4R, and KCTD15 with obesity and type 2 diabetes in 7705 Chinese.
20200978 2010 Replication of previous genome-wide association studies of bone mineral density in premenopausal American women.
19079260 2009 Genome-wide association yields new sequence variants at seven loci that associate with measures of obesity.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17803461 2008 Phorbol ester and hydrogen peroxide synergistically induce the interaction of diacylglycerol kinase gamma with the Src homology 2 and C1 domains of beta2-chimaerin.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
More...