Property Summary

NCBI Gene PubMed Count 25
PubMed Score 20.70
PubTator Score 12.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.400 1.2e-04
ependymoma -1.200 1.1e-04
lung carcinoma 1.800 1.8e-19
malignant mesothelioma 2.200 1.1e-04
osteosarcoma -1.085 1.4e-02
sonic hedgehog group medulloblastoma -1.400 5.5e-03
subependymal giant cell astrocytoma -1.920 1.8e-02

Gene RIF (8)

AA Sequence

MGEERWVSLTPEEFDQLQKYSEYSSKKIKDALTEFNEGGSLKQYDPHEPISYDVFKLFMRAYLEVDLPQP      1 - 70
LSTHLFLAFSQKPRHETSDHPTEGASNSEANSADTNIQNADNATKADEACAPDTESNMAEKQAPAEDQVA     71 - 140
ATPLEPPVPRSSSSESPVVYLKDVVCYLSLLETGRPQDKLEFMFRLYDSDENGLLDQAEMDCIVNQMLHI    141 - 210
AQYLEWDPTELRPILKEMLQGMDYDRDGFVSLQEWVHGGMTTIPLLVLLGMDDSGSKGDGRHAWTMKHFK    211 - 280
KPTYCNFCHIMLMGVRKQGLCCTYCKYTVHERCVSRNIPGCVKTYSKAKRSGEVMQHAWVEGNSSVKCDR    281 - 350
CHKSIKCYQSVTARHCVWCRMTFHRKCELSTLCDGGELRDHILLPTSICPITRDRPGEKSDGCVSAKGEL    351 - 420
VMQYKIIPTPGTHPLLVLVNPKSGGRQGERILRKFHYLLNPKQVFNLDNGGPTPGLNFFRDTPDFRVLAC    421 - 490
GGDGTVGWILDCIDKANFAKHPPVAVLPLGTGNDLARCLRWGGGYEGGSLTKILKDIEQSPLVMLDRWHL    491 - 560
EVIPREEVENGDQVPYSIMNNYFSIGVDASIAHRFHVMREKHPEKFNSRMKNKLWYFEFGTSETFAATCK    561 - 630
KLHDHIELECDGVGVDLSNIFLEGIAILNIPSMYGGTNLWGENKKNRAVIRESRKGVTDPKELKFCVQDL    631 - 700
SDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCASVTIRTNKLLPMQVDGEPWMQPCCTIKITHKNQAPM    701 - 770
MMGPPQKSSFFSLRRKSRSKD                                                     771 - 791
//

Text Mined References (29)

PMID Year Title