Property Summary

NCBI Gene PubMed Count 22
PubMed Score 37.02
PubTator Score 28.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung adenocarcinoma 2716 2.7e-15
osteosarcoma 7950 1.7e-08
invasive ductal carcinoma 2951 3.6e-03

Expression

  Differential Expression (3)

Disease log2 FC p
invasive ductal carcinoma -1.300 3.6e-03
lung adenocarcinoma -1.216 2.7e-15
osteosarcoma 1.606 1.7e-08

Gene RIF (12)

AA Sequence

MSSGAPQKSSPMASGAEETPGFLDTLLQDFPALLNPEDPLPWKAPGTVLSQEEVEGELAELAMGFLGSRK      1 - 70
APPPLAAALAHEAVSQLLQTDLSEFRKLPREEEEEEEDDDEEEKAPVTLLDAQSLAQSFFNRLWEVAGQW     71 - 140
QKQVPLAARASQRQWLVSIHAIRNTRRKMEDRHVSLPSFNQLFGLSDPVNRAYFAVFDGHGGVDAARYAA    141 - 210
VHVHTNAARQPELPTDPEGALREAFRRTDQMFLRKAKRERLQSGTTGVCALIAGATLHVAWLGDSQVILV    211 - 280
QQGQVVKLMEPHRPERQDEKARIEALGGFVSHMDCWRVNGTLAVSRAIGDVFQKPYVSGEADAASRALTG    281 - 350
SEDYLLLACDGFFDVVPHQEVVGLVQSHLTRQQGSGLRVAEELVAAARERGSHDNITVMVVFLRDPQELL    351 - 420
EGGNQGEGDPQAEGRRQDLPSSLPEPETQAPPRS                                        421 - 454
//

Text Mined References (28)

PMID Year Title