Property Summary

NCBI Gene PubMed Count 21
PubMed Score 33.80
PubTator Score 28.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.606 0.000
lung adenocarcinoma -1.334 0.000
invasive ductal carcinoma -1.300 0.004

Synonym

Accession P49593 A8K6G3 B7Z2C3 Q96PM2
Symbols CAMKP
FEM-2
POPX2
hFEM-2
CaMKPase

Gene

Gene RIF (11)

PMID Text
26498692 Overexpression of PPM1F is associated with metastasis of hepatocellular carcinoma.
24338362 POPX2 affects trafficking by determining the phosphorylation status of KIF3A at serine 690.
23621870 POPX2 might regulate cell motility through its regulation of the MAPK1/3, leading to changes in the cytoskeleton and cell motility.
22743349 hCaMKP activity is reversibly regulated by oxidation/reduction at Cys-359
22144583 FHOD1 and PPM1F (direct regulators of the actin cytoskeleton) were identified as novel targets of miR-200c. Expression levels of FHOD1 and PPM1F were inversely correlated with miR-200c level in breast cancer cell lines and breast cancer patient samples.
21656682 Data identify a biochemical pathway through which POPX2 exerts its apparent cellular function: the regulation of activity of glycogen synthase kinase-3, which in turn modulates extracellular signal-regulated kinase and cell motility.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20016286 The POPX2 phosphatase regulates cancer cell motility and invasiveness.
15140879 PPM1F plays a key role in the regulation of CaMKII intracellularly
12539042 Microarray analysis indicates HIV-1 Tat downregulates the expression of many proteins, including protein phosphatase 1F (KIAA0015), in immature dendritic cells, an effect that likely facilitates the expansion of HIV-1 infection
More...

AA Sequence

MSSGAPQKSSPMASGAEETPGFLDTLLQDFPALLNPEDPLPWKAPGTVLSQEEVEGELAELAMGFLGSRK      1 - 70
APPPLAAALAHEAVSQLLQTDLSEFRKLPREEEEEEEDDDEEEKAPVTLLDAQSLAQSFFNRLWEVAGQW     71 - 140
QKQVPLAARASQRQWLVSIHAIRNTRRKMEDRHVSLPSFNQLFGLSDPVNRAYFAVFDGHGGVDAARYAA    141 - 210
VHVHTNAARQPELPTDPEGALREAFRRTDQMFLRKAKRERLQSGTTGVCALIAGATLHVAWLGDSQVILV    211 - 280
QQGQVVKLMEPHRPERQDEKARIEALGGFVSHMDCWRVNGTLAVSRAIGDVFQKPYVSGEADAASRALTG    281 - 350
SEDYLLLACDGFFDVVPHQEVVGLVQSHLTRQQGSGLRVAEELVAAARERGSHDNITVMVVFLRDPQELL    351 - 420
EGGNQGEGDPQAEGRRQDLPSSLPEPETQAPPRS                                        421 - 454
//

Text Mined References (27)

PMID Year Title
26498692 2015 miR-149 represses metastasis of hepatocellular carcinoma by targeting actin-regulatory proteins PPM1F.
24338362 2014 POPX2 phosphatase regulates the KIF3 kinesin motor complex.
23621870 2013 Integrative transcriptome and proteome study to identify the signaling network regulated by POPX2 phosphatase.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22743349 2012 Regulation of Ca(2+)/calmodulin-dependent protein kinase phosphatase (CaMKP) by oxidation/reduction at Cys-359.
22144583 2012 MicroRNA-200c represses migration and invasion of breast cancer cells by targeting actin-regulatory proteins FHOD1 and PPM1F.
21656682 2011 Investigation of POPX2 phosphatase functions by comparative phosphoproteomic analysis.
21269460 2011 Initial characterization of the human central proteome.
20801214 2011 Ppm1E is an in cellulo AMP-activated protein kinase phosphatase.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...