Property Summary

NCBI Gene PubMed Count 31
PubMed Score 230.10
PubTator Score 104.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Protein-protein Interaction (3)

Gene RIF (12)

AA Sequence

MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKK      1 - 70
KEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLH     71 - 140
PSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQY    141 - 210
ALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALH    211 - 280
RDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEE    281 - 350
FYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKV    351 - 420
EFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEG    421 - 490
SKKKAAARDVTLENRLQNMEVTDA                                                  491 - 514
//

Text Mined References (39)

PMID Year Title