Property Summary

NCBI Gene PubMed Count 27
PubMed Score 218.93
PubTator Score 104.30

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P49591 B2R6Y9 Q5T5C8 Q9NSE3
Symbols SERS
SERRS

Gene

PDB

3VBB   4L87   4RQE   4RQF  

Gene RIF (10)

PMID Text
26433229 tRNA recognition mode of SerRS.
24095058 A long-range conformational and functional communication specific to higher eukaryotes is found in human SerRS.
24034276 Several data support that p.R402H mutation in SARS2 is a new cause of HUPRA syndrome.
22353712 study identified a nuclear localization signal sequence embedded in UNE-S domain and showed that the essential role of SerRS in vascular development is dependent on UNE-S and its role to mobilize SerRS from the cytoplasm to the nucleus
22190034 HIV-1 PR is identified to have a physical interaction with seryl-tRNA synthetase (SARS) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21255763 Mutations in the mitochondrial seryl-tRNA synthetase cause hyperuricemia, pulmonary hypertension, renal failure in infancy and alkalosis, HUPRA syndrome.
21045311 Recombinant human cytosolic seryl-tRNA synthetase protein was purified to homogeneity and crystallized. Diffraction data were collected to 3.13 A resolution.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19423847 SARS regulates endothelial sprouting. These analyses of zebrafish and human endothelial cells reveal a new noncanonical function of Sars in endothelial development.

AA Sequence

MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKK      1 - 70
KEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLH     71 - 140
PSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQY    141 - 210
ALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALH    211 - 280
RDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEE    281 - 350
FYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKV    351 - 420
EFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEG    421 - 490
SKKKAAARDVTLENRLQNMEVTDA                                                  491 - 514
//

Text Mined References (34)

PMID Year Title
26433229 2015 SerRS-tRNASec complex structures reveal mechanism of the first step in selenocysteine biosynthesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24095058 2013 Crystal structure of human Seryl-tRNA synthetase and Ser-SA complex reveals a molecular lever specific to higher eukaryotes.
24034276 2013 A new mutation in the gene encoding mitochondrial seryl-tRNA synthetase as a cause of HUPRA syndrome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22353712 2012 Unique domain appended to vertebrate tRNA synthetase is essential for vascular development.
21269460 2011 Initial characterization of the human central proteome.
21255763 2011 Mutations in the mitochondrial seryl-tRNA synthetase cause hyperuricemia, pulmonary hypertension, renal failure in infancy and alkalosis, HUPRA syndrome.
21045311 2010 Crystallization and preliminary X-ray diffraction analysis of human cytosolic seryl-tRNA synthetase.
More...