Property Summary

NCBI Gene PubMed Count 15
Grant Count 55
R01 Count 29
Funding $6,588,994.59
PubMed Score 260.50
PubTator Score 45.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.004 0.000
lung cancer 1.300 0.000
ovarian cancer -1.100 0.000

Gene RIF (5)

PMID Text
22190034 HIV-1 MA is identified to have a physical interaction with histidyl-tRNA synthetase 2, mitochondrial (HARS2; HO3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21464306 Mutations in mitochondrial histidyl tRNA synthetase HARS2 cause ovarian dysgenesis and sensorineural hearing loss of Perrault syndrome.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20381070 This protein has been found differentially expressed in the anterior cingulate cortex in men patients with schizophrenia.
9445076 HIV-1 MA is identified to have a physical interaction with histidyl-tRNA synthetase 2, mitochondrial (HARS2; HO3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MPLLGLLPRRAWASLLSQLLRPPCASCTGAVRCQSQVAEAVLTSQLKAHQEKPNFIIKTPKGTRDLSPQH      1 - 70
MVVREKILDLVISCFKRHGAKGMDTPAFELKETLTEKYGEDSGLMYDLKDQGGELLSLRYDLTVPFARYL     71 - 140
AMNKVKKMKRYHVGKVWRRESPTIVQGRYREFCQCDFDIAGQFDPMIPDAECLKIMCEILSGLQLGDFLI    141 - 210
KVNDRRIVDGMFAVCGVPESKFRAICSSIDKLDKMAWKDVRHEMVVKKGLAPEVADRIGDYVQCHGGVSL    211 - 280
VEQMFQDPRLSQNKQALEGLGDLKLLFEYLTLFGIADKISFDLSLARGLDYYTGVIYEAVLLQTPTQAGE    281 - 350
EPLNVGSVAAGGRYDGLVGMFDPKGHKVPCVGLSIGVERIFYIVEQRMKTKGEKVRTTETQVFVATPQKN    351 - 420
FLQERLKLIAELWDSGIKAEMLYKNNPKLLTQLHYCESTGIPLVVIIGEQELKEGVIKIRSVASREEVAI    421 - 490
KRENFVAEIQKRLSES                                                          491 - 506
//

Text Mined References (22)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21464306 2011 Mutations in mitochondrial histidyl tRNA synthetase HARS2 cause ovarian dysgenesis and sensorineural hearing loss of Perrault syndrome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20381070 2010 Sex-specific proteome differences in the anterior cingulate cortex of schizophrenia.
More...