Property Summary

NCBI Gene PubMed Count 21
Grant Count 255
R01 Count 94
Funding $45,736,273.45
PubMed Score 867.79
PubTator Score 99.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis 2.000 0.000
osteosarcoma 1.183 0.002
glioblastoma 1.300 0.015
medulloblastoma, large-cell 1.300 0.006
juvenile dermatomyositis 1.605 0.000
pediatric high grade glioma 1.100 0.011
non primary Sjogren syndrome sicca 1.100 0.021
ovarian cancer 1.800 0.000
chronic rhinosinusitis -1.052 0.029
dermatomyositis 1.800 0.001

Synonym

Accession P49589 Q53XI8 Q5HYE4 Q9HD24 Q9HD25
Symbols CARS1
CYSRS
MGC:11246

Gene

Gene RIF (8)

PMID Text
26909942 The risk (G and C) and non-risk (C and T) allele frequencies of the SNPs at the rs1888747 and rs739401 loci of FRMD3 and CARS, respectively, did not differ significantly between the diabetics with (case) and without (control) nephropathy (P > 0.05).
26184909 Loss of CARS, the cysteinyl-tRNA synthetase, suppresses ferroptosis induced by erastin, which inhibits the cystine-glutamate antiporter known as system xc(-).
20460425 Observational study of gene-disease association. (HuGE Navigator)
20306291 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20201924 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19252134 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17303165 Specificity of anticodon recognition by human CysRS is higher than that of its bacterial counterparts.
12112524 CARS is a novel fusion partner of anaplastic lymphoma kinase in anaplastic large-cell lymphoma and inflammatory myofibroblastic tumor cases.

AA Sequence

MADSSGQQGKGRRVQPQWSPPAGTQPCRLHLYNSLTRNKEVFIPQDGKKVTWYCCGPTVYDASHMGHARS      1 - 70
YISFDILRRVLKDYFKFDVFYCMNITDIDDKIIKRARQNHLFEQYREKRPEAAQLLEDVQAALKPFSVKL     71 - 140
NETTDPDKKQMLERIQHAVQLATEPLEKAVQSRLTGEEVNSCVEVLLEEAKDLLSDWLDSTLGCDVTDNS    141 - 210
IFSKLPKFWEGDFHRDMEALNVLPPDVLTRVSEYVPEIVNFVQKIVDNGYGYVSNGSVYFDTAKFASSEK    211 - 280
HSYGKLVPEAVGDQKALQEGEGDLSISADRLSEKRSPNDFALWKASKPGEPSWPCPWGKGRPGWHIECSA    281 - 350
MAGTLLGASMDIHGGGFDLRFPHHDNELAQSEAYFENDCWVRYFLHTGHLTIAGCKMSKSLKNFITIKDA    351 - 420
LKKHSARQLRLAFLMHSWKDTLDYSSNTMESALQYEKFLNEFFLNVKDILRAPVDITGQFEKWGEEEAEL    421 - 490
NKNFYDKKTAIHKALCDNVDTRTVMEEMRALVSQCNLYMAARKAVRKRPNQALLENIALYLTHMLKIFGA    491 - 560
VEEDSSLGFPVGGPGTSLSLEATVMPYLQVLSEFREGVRKIAREQKVPEILQLSDALRDNILPELGVRFE    561 - 630
DHEGLPTVVKLVDRNTLLKEREEKRRVEEEKRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSK    631 - 700
FDENGLPTHDMEGKELSKGQAKKLKKLFEAQEKLYKEYLQMAQNGSFQ                          701 - 748
//

Text Mined References (30)

PMID Year Title
26909942 2016 Evaluation of associations between single nucleotide polymorphisms in the FRMD3 and CARS genes and diabetic nephropathy in a Kuwaiti population.
26184909 2016 Loss of cysteinyl-tRNA synthetase (CARS) induces the transsulfuration pathway and inhibits ferroptosis induced by cystine deprivation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24068962 2013 Meta-analysis of genome-wide association studies identifies six new Loci for serum calcium concentrations.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20834067 2010 Joint influence of small-effect genetic variants on human longevity.
20460425 2010 Replication study for the association between four Loci identified by a genome-wide association study on European American subjects with type 1 diabetes and susceptibility to diabetic nephropathy in Japanese subjects with type 2 diabetes.
20306291 2010 A three-stage genome-wide association study of general cognitive ability: hunting the small effects.
More...