Property Summary

NCBI Gene PubMed Count 27
PubMed Score 295.20
PubTator Score 130.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
malignant mesothelioma 3232 6.1e-06
ovarian cancer 8520 8.9e-06
psoriasis 6694 1.1e-03
astrocytoma 1146 6.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytoma 1.200 6.7e-03
malignant mesothelioma 1.200 6.1e-06
ovarian cancer 1.200 8.9e-06
psoriasis 1.200 1.1e-03

Synonym

Accession P49588 A6NF14 B4DR45 Q53GV7 Q96FA0
Symbols CMT2N
EIEE29

Gene

Gene RIF (8)

AA Sequence

MDSTLTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPSHPMAKLSRAA      1 - 70
NTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALELLTQEFGIPIERLYVTYFGG     71 - 140
DEAAGLEADLECKQIWQNLGLDDTKILPGNMKDNFWEMGDTGPCGPCSEIHYDRIGGRDAAHLVNQDDPN    141 - 210
VLEIWNLVFIQYNREADGILKPLPKKSIDTGMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYT    211 - 280
GKVGAEDADGIDMAYRVLADHARTITVALADGGRPDNTGRGYVLRRILRRAVRYAHEKLNASRGFFATLV    281 - 350
DVVVQSLGDAFPELKKDPDMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGDSKTIPGDTAWLLYDTYGF    351 - 420
PVDLTGLIAEEKGLVVDMDGFEEERKLAQLKSQGKGAGGEDLIMLDIYAIEELRARGLEVTDDSPKYNYH    421 - 490
LDSSGSYVFENTVATVMALRREKMFVEEVSTGQECGVVLDKTCFYAEQGGQIYDEGYLVKVDDSSEDKTE    491 - 560
FTVKNAQVRGGYVLHIGTIYGDLKVGDQVWLFIDEPRRRPIMSNHTATHILNFALRSVLGEADQKGSLVA    561 - 630
PDRLRFDFTAKGAMSTQQIKKAEEIANEMIEAAKAVYTQDCPLAAAKAIQGLRAVFDETYPDPVRVVSIG    631 - 700
VPVSELLDDPSGPAGSLTSVEFCGGTHLRNSSHAGAFVIVTEEAIAKGIRRIVAVTGAEAQKALRKAESL    701 - 770
KKCLSVMEAKVKAQTAPNKDVQREIADLGEALATAVIPQWQKDELRETLKSLKKVMDDLDRASKADVQKR    771 - 840
VLEKTKQFIDSNPNQPLVILEMESGASAKALNEALKLFKMHSPQTSAMLFTVDNEAGKITCLCQVPQNAA    841 - 910
NRGLKASEWVQQVSGLMDGKGGGKDVSAQATGKNVGCLQEALQLATSFAQLRLGDVKN                911 - 968
//

Text Mined References (42)

PMID Year Title