Property Summary

NCBI Gene PubMed Count 24
PubMed Score 242.66
PubTator Score 40.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
cone-rod dystrophy 59 4.096 2.0

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 3.5e-07
glioblastoma 1.200 3.7e-05
intraductal papillary-mucinous adenoma (... 1.400 1.4e-03
intraductal papillary-mucinous carcinoma... 1.200 3.5e-03
intraductal papillary-mucinous neoplasm ... 1.400 1.3e-02
lung cancer -1.100 1.5e-02
malignant mesothelioma 1.200 3.5e-06
osteosarcoma -1.197 1.5e-04
ovarian cancer -1.100 4.6e-04
psoriasis -1.300 2.0e-03

Gene RIF (10)

AA Sequence

MDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRG      1 - 70
TPCERPVRVYADGIFDLFHSGHARALMQAKNLFPNTYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCR     71 - 140
YVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKEAGMFAPTQRTEGISTSDIITRIV    141 - 210
RDYDVYARRNLQRGYTAKELNVSFINEKKYHLQERVDKVKKKVKDVEEKSKEFVQKVEEKSIDLIQKWEE    211 - 280
KSREFIGSFLEMFGPEGALKHMLKEGKGRMLQAISPKQSPSSSPTRERSPSPSFRWPFSGKTSPPCSPAN    281 - 350
LSRHKAAAYDISEDEED                                                         351 - 367
//

Text Mined References (35)

PMID Year Title