Property Summary

NCBI Gene PubMed Count 35
Grant Count 12
R01 Count 8
Funding $687,703.73
PubMed Score 30.66
PubTator Score 23.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.110 0.016
glioblastoma 1.200 0.003
Breast cancer 2.800 0.033
pediatric high grade glioma 1.100 0.000
ovarian cancer 2.000 0.000

 GWAS Trait (1)

Gene RIF (14)

PMID Text
26336826 Data show that the ubiquitin-conjugating enzyme E2 RAD6A/B-MDM2 ubiquitin ligase machinery regulates anti-silencing function 1A protein (ASF1A) degradation.
25582440 Results showed KCMF1 C-terminus binds directly to RAD6, whereas N-terminal domains interact with UBR4 and point mutations found in X-linked intellectual disability (XLID) patients specifically lose the interaction with KCMF1 and UBR4.
25384975 RAD6 physically interacts with heterochromatin protein 1alpha and ubiquitinates HP1alpha at residue K154, thereby promoting heterochromatin protein 1alpha degradation through the autophagy pathway
25287747 This study investigates clinical and molecular data of two unrelated, affected males with chromosome Xq24 deletions encompassing UBE2A.
24036990 HHR6 and hRad18 can monoubiquitinate FANCD2 at lysine 561 in vitro. This activity may represent a novel stress response pathway.
23685073 RAD6A is a regulator of Parkin-dependent mitophagy plays a critical role in maintaining neuronal function.
23525009 RNF168, in complex with RAD6A or RAD6B, is activated in the DNA-damage-induced protein ubiquitination cascade.
22592529 UBE2A specifically interacts with CDK9, but not CDK2 and is phosphorylated by CDK9 in vitro.
22083959 RAD6 can form a ternary complex with MDM2 and p53 that contributes to the degradation of p53.
21108393 UBE2A deficiency syndrome is reported in two male patients.
More...

AA Sequence

MSTPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTV      1 - 70
RFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKR     71 - 140
VSAIVEQSWRDC                                                              141 - 152
//

Text Mined References (39)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26336826 2015 A conserved RAD6-MDM2 ubiquitin ligase machinery targets histone chaperone ASF1A in tumorigenesis.
25582440 2015 KCMF1 (potassium channel modulatory factor 1) Links RAD6 to UBR4 (ubiquitin N-recognin domain-containing E3 ligase 4) and lysosome-mediated degradation.
25416956 2014 A proteome-scale map of the human interactome network.
25384975 2015 RAD6 promotes homologous recombination repair by activating the autophagy-mediated degradation of heterochromatin protein HP1.
25287747 2015 UBE2A deficiency syndrome: a report of two unrelated cases with large Xq24 deletions encompassing UBE2A gene.
24036990 2013 In vitro FANCD2 monoubiquitination by HHR6 and hRad18.
23685073 2013 Mutations in the intellectual disability gene Ube2a cause neuronal dysfunction and impair parkin-dependent mitophagy.
23525009 2013 RNF168 forms a functional complex with RAD6 during the DNA damage response.
23471985 2013 Genome-wide scan of healthy human connectome discovers SPON1 gene variant influencing dementia severity.
More...