Property Summary

NCBI Gene PubMed Count 37
PubMed Score 32.32
PubTator Score 23.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
MENTAL RETARDATION, X-LINKED, SYNDROMIC, NASCIMENTO TYPE 1 0.0 0.0
Disease Target Count P-value
pediatric high grade glioma 1064 3.1e-05
ovarian cancer 8520 7.2e-04
glioblastoma 5792 2.9e-03
Multiple myeloma 1332 1.6e-02
Breast cancer 3578 3.3e-02
Disease Target Count Z-score Confidence
Male infertility 206 3.004 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 2.800 3.3e-02
glioblastoma 1.200 2.9e-03
Multiple myeloma 1.110 1.6e-02
ovarian cancer -1.300 7.2e-04
pediatric high grade glioma 1.100 3.1e-05

 GWAS Trait (1)

Gene RIF (16)

AA Sequence

MSTPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTV      1 - 70
RFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKR     71 - 140
VSAIVEQSWRDC                                                              141 - 152
//

Text Mined References (41)

PMID Year Title