Property Summary

NCBI Gene PubMed Count 98
Grant Count 188
R01 Count 122
Funding $35,326,668.73
PubMed Score 532.85
PubTator Score 327.06

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P49450 D6W544 Q53T74 Q9BVW2
Symbols CenH3
CENP-A

Gene

PDB

3AN2   3WTP   5CVD   3NQJ   3NQU   3R45  

Gene RIF (68)

PMID Text
26878239 The authors found that the nucleosome shape change directed by CENP-A is dominated by lateral passing of two DNA gyres (gyre sliding).
26527398 CENP-C and CENP-I are key factors connecting kinetochore to CENP-A assembly.
25954010 CENP-C depletion leads to rapid removal of CENP-A from centromeres, indicating their collaboration in maintaining centromere identity.
25942623 CENP-B directly binds both CENP-A's amino-terminal tail and CENP-C, a key nucleator of kinetochore assembly
25843710 We used a synthetic system to dissect how CenH3(CENP-A) contributes to the accumulation of CENP-C and CENP-T, two key components that are necessary for the formation of functional kinetochores
25795299 the CRL4 complex containing RBBP7 (CRL4(RBBP7)) might regulate mitosis by promoting ubiquitin-dependent loading of newly synthesized CENP-A during the G1 phase of the cell cycle.
25786215 The DNA ends of the CENP-A nucleosome are more flexible than those of the H3 nucleosome.
25713413 results indicate that the regions of CENP-A required for early events in centromere establishment differ from those that are required for maintaining centromere identity.
25408271 The CENP-A/histone H3.3 nucleosome forms an unexpectedly stable structure and allows the binding of the essential centromeric protein, CENP-C, which is ectopically mislocalized in the chromosomes of CENP-A overexpressing tumor cells.
25117489 The study describes a novel function for human centromeric long non-coding RNAs in the recruitment of HJURP and CENP-A, implicating RNA-based chaperone targeting in histone variant assembly.
More...

AA Sequence

MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRL      1 - 70
AREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG     71 - 140
//

Text Mined References (107)

PMID Year Title
27499292 2016 The Flexible Ends of CENP-A Nucleosome Are Required for Mitotic Fidelity.
26878239 2016 CENP-C directs a structural transition of CENP-A nucleosomes mainly through sliding of DNA gyres.
26543159 2015 Molecular basis for histone N-terminal methylation by NRMT1.
26527398 2015 CENP-C and CENP-I are key connecting factors for kinetochore and CENP-A assembly.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25954010 2015 Chromosomes. CENP-C reshapes and stabilizes CENP-A nucleosomes at the centromere.
25942623 2015 DNA Sequence-Specific Binding of CENP-B Enhances the Fidelity of Human Centromere Function.
25843710 2015 HJURP involvement in de novo CenH3(CENP-A) and CENP-C recruitment.
25795299 2015 CRL4(RBBP7) is required for efficient CENP-A deposition at centromeres.
25786215 2015 Two arginine residues suppress the flexibility of nucleosomal DNA in the canonical nucleosome core.
More...