Property Summary

NCBI Gene PubMed Count 109
PubMed Score 566.97
PubTator Score 327.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
adrenocortical carcinoma 1.947 1.5e-03
adult high grade glioma 2.100 1.5e-04
Atopic dermatitis 1.400 1.6e-03
atypical teratoid / rhabdoid tumor 3.600 5.0e-13
Breast cancer 3.000 1.5e-17
breast carcinoma 1.400 7.2e-30
colon cancer 1.800 7.5e-03
ductal carcinoma in situ 2.500 2.3e-03
Endometriosis 1.758 1.2e-02
ependymoma 1.700 2.7e-06
glioblastoma 3.000 9.2e-10
group 3 medulloblastoma 4.200 1.1e-09
intraductal papillary-mucinous carcinoma... 2.300 2.7e-04
intraductal papillary-mucinous neoplasm ... 2.700 6.0e-04
invasive ductal carcinoma 3.400 1.3e-04
lung adenocarcinoma 1.100 1.8e-11
lung cancer 3.000 1.4e-05
malignant mesothelioma 1.700 1.3e-07
medulloblastoma, large-cell 3.900 1.6e-07
nasopharyngeal carcinoma 1.200 5.5e-04
non-small cell lung cancer 3.483 2.1e-33
osteosarcoma -2.013 2.2e-02
ovarian cancer 2.400 9.3e-06
pancreatic cancer 1.200 1.2e-04
primitive neuroectodermal tumor 3.800 1.3e-07
psoriasis 1.200 7.3e-25
ulcerative colitis 1.300 5.9e-04

Protein-protein Interaction (8)

Gene RIF (79)

AA Sequence

MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRL      1 - 70
AREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG     71 - 140
//

Text Mined References (119)

PMID Year Title