Property Summary

NCBI Gene PubMed Count 98
PubMed Score 532.85
PubTator Score 327.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
non-small cell lung cancer 2798 2.12051853372211E-33
breast carcinoma 1614 7.24544778153178E-30
Breast cancer 3099 1.54279113481132E-17
atypical teratoid / rhabdoid tumor 4369 4.97122276774032E-13
group 3 medulloblastoma 2254 1.13056357942221E-9
psoriasis 6685 1.00460346524922E-8
primitive neuroectodermal tumor 3031 1.34894106169362E-7
medulloblastoma, large-cell 6234 1.55094189260226E-7
malignant mesothelioma 3163 2.23290114799906E-7
pediatric high grade glioma 2712 1.16130708155827E-6
posterior fossa group A ependymoma 1511 5.31438585330992E-6
lung adenocarcinoma 2714 5.95653741779395E-6
ovarian cancer 8492 9.27363948513248E-6
glioblastoma 5572 1.89034247683778E-5
lung cancer 4473 6.72224716887662E-5
pancreatic cancer 2300 1.23669411381534E-4
invasive ductal carcinoma 2950 1.33213907612412E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.71330662249325E-4
nasopharyngeal carcinoma 1056 5.52843556648492E-4
ulcerative colitis 2087 5.89672704165153E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 5.99584482905136E-4
adrenocortical carcinoma 1427 0.00149255371349885
Atopic dermatitis 944 0.00164952395288967
ductal carcinoma in situ 1745 0.00226533375246666
colon cancer 1475 0.00753948675453493
Endometriosis 535 0.0120848772050226
osteosarcoma 7933 0.021551234223659

Expression

Synonym

Accession P49450 D6W544 Q53T74 Q9BVW2
Symbols CenH3
CENP-A

Gene

PDB

3AN2   3WTP   5CVD   3NQJ   3NQU   3R45  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG
Xenopus EggNOG Inparanoid

Gene RIF (68)

PMID Text
26878239 The authors found that the nucleosome shape change directed by CENP-A is dominated by lateral passing of two DNA gyres (gyre sliding).
26527398 CENP-C and CENP-I are key factors connecting kinetochore to CENP-A assembly.
25954010 CENP-C depletion leads to rapid removal of CENP-A from centromeres, indicating their collaboration in maintaining centromere identity.
25942623 CENP-B directly binds both CENP-A's amino-terminal tail and CENP-C, a key nucleator of kinetochore assembly
25843710 We used a synthetic system to dissect how CenH3(CENP-A) contributes to the accumulation of CENP-C and CENP-T, two key components that are necessary for the formation of functional kinetochores
25795299 the CRL4 complex containing RBBP7 (CRL4(RBBP7)) might regulate mitosis by promoting ubiquitin-dependent loading of newly synthesized CENP-A during the G1 phase of the cell cycle.
25786215 The DNA ends of the CENP-A nucleosome are more flexible than those of the H3 nucleosome.
25713413 results indicate that the regions of CENP-A required for early events in centromere establishment differ from those that are required for maintaining centromere identity.
25408271 The CENP-A/histone H3.3 nucleosome forms an unexpectedly stable structure and allows the binding of the essential centromeric protein, CENP-C, which is ectopically mislocalized in the chromosomes of CENP-A overexpressing tumor cells.
25117489 The study describes a novel function for human centromeric long non-coding RNAs in the recruitment of HJURP and CENP-A, implicating RNA-based chaperone targeting in histone variant assembly.
More...

AA Sequence

MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRL      1 - 70
AREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG     71 - 140
//

Text Mined References (107)

PMID Year Title
27499292 2016 The Flexible Ends of CENP-A Nucleosome Are Required for Mitotic Fidelity.
26878239 2016 CENP-C directs a structural transition of CENP-A nucleosomes mainly through sliding of DNA gyres.
26543159 2015 Molecular basis for histone N-terminal methylation by NRMT1.
26527398 2015 CENP-C and CENP-I are key connecting factors for kinetochore and CENP-A assembly.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25954010 2015 Chromosomes. CENP-C reshapes and stabilizes CENP-A nucleosomes at the centromere.
25942623 2015 DNA Sequence-Specific Binding of CENP-B Enhances the Fidelity of Human Centromere Function.
25843710 2015 HJURP involvement in de novo CenH3(CENP-A) and CENP-C recruitment.
25795299 2015 CRL4(RBBP7) is required for efficient CENP-A deposition at centromeres.
25786215 2015 Two arginine residues suppress the flexibility of nucleosomal DNA in the canonical nucleosome core.
More...