Property Summary

NCBI Gene PubMed Count 41
PubMed Score 14.61
PubTator Score 52.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.500 1.9e-03
Astrocytoma, Pilocytic 1.800 3.4e-06
atypical teratoid / rhabdoid tumor 1.100 4.9e-02
Down syndrome 1.400 1.3e-03
esophageal adenocarcinoma -1.200 4.7e-02
glioblastoma -1.300 2.4e-02
group 4 medulloblastoma -1.400 1.3e-03
medulloblastoma, large-cell -1.200 4.5e-03
osteosarcoma 1.577 1.1e-04
pancreatic ductal adenocarcinoma liver m... -3.569 6.6e-04
primitive neuroectodermal tumor -1.200 2.3e-03
psoriasis -1.100 2.1e-02

Protein-protein Interaction (1)

Gene RIF (27)

AA Sequence

MYRYLAKALLPSRAGPAALGSAANHSAALLGRGRGQPAAASQPGLALAARRHYSELVADREDDPNFFKMV      1 - 70
EGFFDRGASIVEDKLVKDLRTQESEEQKRNRVRGILRIIKPCNHVLSLSFPIRRDDGSWEVIEGYRAQHS     71 - 140
QHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKNYTENELEKITRRFTMELA    141 - 210
KKGFIGPGVDVPAPDMNTGEREMSWIADTYASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGI    211 - 280
ENFINEASYMSILGMTPGFRDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELED    281 - 350
FKLQHGSILGFPKAKPYEGSILEVDCDILIPAATEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLER    351 - 420
NILVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLLSVQESLERKFGKHGGTIPIVPT    421 - 490
AEFQDSISGASEKDIVHSALAYTMERSARQIMHTAMKYNLGLDLRTAAYVNAIEKVFKVYSEAGVTFT      491 - 558
//

Text Mined References (44)

PMID Year Title