Property Summary

NCBI Gene PubMed Count 36
PubMed Score 13.61
PubTator Score 52.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
esophageal adenocarcinoma -1.200 0.047
psoriasis -1.100 0.021
osteosarcoma 1.577 0.000
medulloblastoma -1.700 0.000
glioblastoma 1.800 0.040
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -1.200 0.005
primitive neuroectodermal tumor -1.200 0.002
pancreatic ductal adenocarcinoma liver m... -3.569 0.001
adult high grade glioma -1.500 0.002
pilocytic astrocytoma 1.700 0.000
Down syndrome 1.400 0.001

Synonym

Accession P49448 B2R8G0 Q9UDQ4 GDH 2
Symbols GDH2
GLUDP1

Gene

PANTHER Protein Class (2)

Gene RIF (22)

PMID Text
26241911 Study of the expression of the GDH1/2 in human steroidogenic organs revealed that, while GDH2 was expressed specifically in steroid-synthesizing cells, GDH1 was expressed both in the cells that produce steroids and in those that lack endocrine function.
25225364 IDH1(R132H) exhibits a growth-inhibitory effect that is abrogated in the presence of glutamate dehydrogenase 2 (GLUD2), a hominoid-specific enzyme purportedly optimized to facilitate glutamate turnover in human forebrain.
24352816 hGDH2 can operate efficiently in the relatively acidic environment that prevails in astrocytes following glutamate uptake [review]
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of glutamate dehydrogenase 2 (GLUD2) expression by HIV-1 Vpr in Vpr transduced macrophages
22709669 first N-terminal alpha helical structure is crucial for the mitochondrial import of hGDH2 and these findings may have implications in understanding the evolutionary mechanisms that led to the large mitochondrial targeting signals of human GDHs
22658952 first N-terminal alpha helical structure is crucial for the mitochondrial import of hGDH2 and these findings may have implications in understanding the evolutionary mechanisms that led to the large mitochondrial targeting signals of human GDHs
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
21621574 Human GDH1 appears to act like bovine GDH1, but human GDH2 does not show the same enhancement of branched chain alpha-keto acid dehydrogenase complex enzyme activities.
21420458 [review] Whereas GDH2 in most mammals is encoded by a single functional GLUD1 gene expressed widely, humans have acquired through retroposition an X-linked GLUD2 gene that encodes a highly homologous isoenzyme GDH2 expressed in testis and brain.
20194501 GLUD2 glutamate dehydrogenase is expressed in neural and testicular supporting cells
More...

AA Sequence

MYRYLAKALLPSRAGPAALGSAANHSAALLGRGRGQPAAASQPGLALAARRHYSELVADREDDPNFFKMV      1 - 70
EGFFDRGASIVEDKLVKDLRTQESEEQKRNRVRGILRIIKPCNHVLSLSFPIRRDDGSWEVIEGYRAQHS     71 - 140
QHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKNYTENELEKITRRFTMELA    141 - 210
KKGFIGPGVDVPAPDMNTGEREMSWIADTYASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGI    211 - 280
ENFINEASYMSILGMTPGFRDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELED    281 - 350
FKLQHGSILGFPKAKPYEGSILEVDCDILIPAATEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLER    351 - 420
NILVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLLSVQESLERKFGKHGGTIPIVPT    421 - 490
AEFQDSISGASEKDIVHSALAYTMERSARQIMHTAMKYNLGLDLRTAAYVNAIEKVFKVYSEAGVTFT      491 - 558
//

Text Mined References (39)

PMID Year Title
26241911 2015 Expression of human GLUD1 and GLUD2 glutamate dehydrogenases in steroid producing tissues.
25225364 2014 Hominoid-specific enzyme GLUD2 promotes growth of IDH1R132H glioma.
24352816 2014 The discovery of human of GLUD2 glutamate dehydrogenase and its implications for cell function in health and disease.
22709669 2012 Alpha helical structures in the leader sequence of human GLUD2 glutamate dehydrogenase responsible for mitochondrial import.
22658952 2012 The complex regulation of human glud1 and glud2 glutamate dehydrogenases and its implications in nerve tissue biology.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
21621574 2011 Interaction between glutamate dehydrogenase (GDH) and L-leucine catabolic enzymes: intersecting metabolic pathways.
21420458 2011 The human GLUD2 glutamate dehydrogenase and its regulation in health and disease.
21269460 2011 Initial characterization of the human central proteome.
20194501 2010 Human GLUD2 glutamate dehydrogenase is expressed in neural and testicular supporting cells.
More...