Property Summary

NCBI Gene PubMed Count 17
Grant Count 10
R01 Count 5
Funding $1,282,698.99
PubMed Score 20.44
PubTator Score 46.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.600 0.001
oligodendroglioma -1.600 0.030
psoriasis -1.900 0.000
osteosarcoma -1.413 0.012
primary pancreatic ductal adenocarcinoma -1.483 0.002
posterior fossa group B ependymoma 1.100 0.000
Pick disease -1.100 0.007
ductal carcinoma in situ 1.300 0.007
invasive ductal carcinoma 1.800 0.001
ovarian cancer 1.100 0.001
pancreatic cancer -1.500 0.001

Pathway (1)

Gene RIF (5)

PMID Text
24140660 We studied hereditary control of HR with the twin pair design, at rest and during environmental (cold) stress. Single nucleotide polymorphism disruption of a microribonucleic acid (microRNA) recognition motif in the human CYB561 3'-UTR was identified .
20680310 Observational study of gene-disease association. (HuGE Navigator)
18180394 Observational study of gene-disease association. (HuGE Navigator)
12837283 CYB561 is a senescene-associated gene in normal human oral keratinocytes.
12768339 structural features in the cyt b(561) family are well conserved at both the sequence and the protein level

AA Sequence

MEGGAAAATPTALPYYVAFSQLLGLTLVAMTGAWLGLYRGGIAWESDLQFNAHPLCMVIGLIFLQGNALL      1 - 70
VYRVFRNEAKRTTKVLHGLLHIFALVIALVGLVAVFDYHRKKGYADLYSLHSWCGILVFVLYFVQWLVGF     71 - 140
SFFLFPGASFSLRSRYRPQHIFFGATIFLLSVGTALLGLKEALLFNLGGKYSAFEPEGVLANVLGLLLAC    141 - 210
FGGAVLYILTRADWKRPSQAEEQALSMDFKTLTEGDSPGSQ                                 211 - 251
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25340798 2014 Genome-wide association study of CSF levels of 59 alzheimer's disease candidate proteins: significant associations with proteins involved in amyloid processing and inflammation.
24140660 2014 Human heart rate: heritability of resting and stress values in twin pairs, and influence of genetic variation in the adrenergic pathway at a microribonucleic acid (microrna) motif in the 3'-UTR of cytochrome b561 [corrected].
23249217 2013 Cytochromes b561: ascorbate-mediated trans-membrane electron transport.
20680310 2010 Nucleotide variations in mitochondrial DNA and supra-physiological ROS levels in cytogenetically normal cases of premature ovarian insufficiency.
18180394 2008 Genetic variation within adrenergic pathways determines in vivo effects of presynaptic stimulation in humans.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...