Property Summary

NCBI Gene PubMed Count 21
PubMed Score 18.05
PubTator Score 20.16

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (14)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 4.1e-03
Breast cancer -1.800 9.6e-15
invasive ductal carcinoma -1.023 1.6e-03
lung adenocarcinoma -1.200 5.1e-15
lung cancer -2.700 2.7e-04
lung carcinoma 1.200 2.3e-12
malignant mesothelioma -1.500 9.0e-07
medulloblastoma -1.200 3.6e-03
medulloblastoma, large-cell -2.200 5.0e-07
Multiple myeloma 1.331 2.7e-02
ovarian cancer -1.700 5.4e-06
posterior fossa group B ependymoma -1.100 1.4e-05
subependymal giant cell astrocytoma -1.003 4.5e-02
urothelial carcinoma -1.200 3.5e-02

Synonym

Accession P49441 IPP
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (9)

AA Sequence

MSDILRELLCVSEKAANIARACRQQEALFQLLIEEKKEGEKNKKFAVDFKTLADVLVQEVIKQNMENKFP      1 - 70
GLEKNIFGEESNEFTNDWGEKITLRLCSTEEETAELLSKVLNGNKVASEALARVVHQDVAFTDPTLDSTE     71 - 140
INVPQDILGIWVDPIDSTYQYIKGSADIKSNQGIFPCGLQCVTILIGVYDIQTGVPLMGVINQPFVSRDP    141 - 210
NTLRWKGQCYWGLSYMGTNMHSLQLTISRRNGSETHTGNTGSEAAFSPSFSAVISTSEKETIKAALSRVC    211 - 280
GDRIFGAAGAGYKSLCVVQGLVDIYIFSEDTTFKWDSCAAHAILRAMGGGIVDLKECLERNPETGLDLPQ    281 - 350
LVYHVENEGAAGVDRWANKGGLIAYRSRKRLETFLSLLVQNLAPAETHT                         351 - 399
//

Text Mined References (24)

PMID Year Title