Property Summary

NCBI Gene PubMed Count 52
PubMed Score 125.78
PubTator Score 53.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.500 1.5e-03
ovarian cancer 2.000 3.8e-07

Protein-protein Interaction (4)

Gene RIF (26)

AA Sequence

MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPY      1 - 70
SPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPA     71 - 140
NVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDY    141 - 210
YEDGEVEEEADSCFGDDEDDSGTEES                                                211 - 236
//

Text Mined References (63)

PMID Year Title