Property Summary

NCBI Gene PubMed Count 51
Grant Count 59
R01 Count 36
Funding $7,282,624.03
PubMed Score 124.58
PubTator Score 53.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
lung cancer 4,466
ovarian cancer 8,484

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.800 0.000
ovarian cancer 2.000 0.000

Gene RIF (25)

PMID Text
25471371 ubiquitin binding by the acidic loops of Ube2g1 and Ube2r1 enzymes distinguishes their Lys-48-ubiquitylation activities
25425648 We discuss how these results can explain the rapid association of Cdc34 and SCF.
24129577 Here we have investigated how the acidic loop in human Cdc34 promotes ubiquitination, identifying two key molecular events during which the acidic loop exerts its influence
23465077 These data suggest that FBXO15 and Ube2r1 regulate P-gp expression through the ubiquitin-proteasome pathway.
22286100 Data show that anaphase-promoting complex or cyclosome (APC/C)-mediated multiple monoubiquitylation targeting cyclin B1 for degradation.
22210895 Tristetraprolin promotes an increase in expression of mature let-7, which leads to the inhibition of let-7 target gene CDC34 expression and suppresses cell growth.
22190037 CUL5/RBX2/ELOB/ELOC/Vif/CBF-beta complex catalyzes polyubiquitin chain formation on A3G in the presence of ubiquitin E2 UBE2R1 (CDC34) or UBCH5b (UBE2D2)
21296085 work provides the first structural details that show how the C-terminus of CDC34 might direct a thiolester-bound Ub to control polyubiquitin chain formation
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20378537 COP9 signalosome protects ubiquitin-conjugating enzyme 3 (UBC3/Cdc34) from beta-transducin repeat-containing protein (betaTrCP)-mediated degradation
More...

AA Sequence

MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPY      1 - 70
SPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPA     71 - 140
NVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDY    141 - 210
YEDGEVEEEADSCFGDDEDDSGTEES                                                211 - 236
//

Text Mined References (59)

PMID Year Title
25471371 2015 Differential ubiquitin binding by the acidic loops of Ube2g1 and Ube2r1 enzymes distinguishes their Lys-48-ubiquitylation activities.
25425648 2015 Ubiquitin-conjugating enzyme Cdc34 and ubiquitin ligase Skp1-cullin-F-box ligase (SCF) interact through multiple conformations.
25416956 2014 A proteome-scale map of the human interactome network.
24882218 2014 Unanchored K48-linked polyubiquitin synthesized by the E3-ubiquitin ligase TRIM6 stimulates the interferon-IKK? kinase-mediated antiviral response.
24129577 2013 Multimodal mechanism of action for the Cdc34 acidic loop: a case study for why ubiquitin-conjugating enzymes have loops and tails.
23465077 2013 FBXO15 regulates P-glycoprotein/ABCB1 expression through the ubiquitin--proteasome pathway in cancer cells.
22286100 2012 APC/C-mediated multiple monoubiquitylation provides an alternative degradation signal for cyclin B1.
22210895 2012 Ectopic over-expression of tristetraprolin in human cancer cells promotes biogenesis of let-7 by down-regulation of Lin28.
22087249 2011 Nutrient sensing kinases PKA and Sch9 phosphorylate the catalytic domain of the ubiquitin-conjugating enzyme Cdc34.
21296085 2011 Association of the disordered C-terminus of CDC34 with a catalytically bound ubiquitin.
More...