Property Summary

NCBI Gene PubMed Count 51
PubMed Score 1303.91
PubTator Score 167.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
Breast cancer 3578 1.2e-21
breast carcinoma 1638 1.4e-05
cystic fibrosis 1696 1.3e-03
acute myeloid leukemia 783 3.1e-02
Disease Target Count Z-score Confidence
Osteoporosis 363 0.0 3.0
Disease Target Count Z-score Confidence
Epilepsy 792 3.485 1.7
Disease Target Count
EPILEPSY, PYRIDOXINE-DEPENDENT 1

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia -2.500 3.1e-02
Breast cancer -1.500 1.2e-21
breast carcinoma -1.100 1.4e-05
cystic fibrosis -1.100 1.3e-03

 MGI Phenotype (1)

Gene RIF (36)

AA Sequence

MWRLPRALCVHAAKTSKLSGPWSRPAAFMSTLLINQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYC      1 - 70
PANNEPIARVRQASVADYEETVKKAREAWKIWADIPAPKRGEIVRQIGDALREKIQVLGSLVSLEMGKIL     71 - 140
VEGVGEVQEYVDICDYAVGLSRMIGGPILPSERSGHALIEQWNPVGLVGIITAFNFPVAVYGWNNAIAMI    141 - 210
CGNVCLWKGAPTTSLISVAVTKIIAKVLEDNKLPGAICSLTCGGADIGTAMAKDERVNLLSFTGSTQVGK    211 - 280
QVGLMVQERFGRSLLELGGNNAIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRL    281 - 350
KKAYAQIRVGNPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLGHD    351 - 420
ASIAHTETFAPILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGA    421 - 490
EIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ                         491 - 539
//

Text Mined References (55)

PMID Year Title