Property Summary

NCBI Gene PubMed Count 53
Grant Count 96
R01 Count 50
Funding $6,608,287.69
PubMed Score 426.15
PubTator Score 74.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytoma -3.300 0.002
ependymoma -3.800 0.002
oligodendroglioma -2.100 0.014
glioblastoma -3.900 0.000
osteosarcoma 2.581 0.015
cystic fibrosis 1.239 0.000
atypical teratoid / rhabdoid tumor -2.900 0.000
medulloblastoma -1.300 0.000
medulloblastoma, large-cell -3.800 0.000
primitive neuroectodermal tumor -1.700 0.014
pediatric high grade glioma -2.900 0.000
pilocytic astrocytoma -1.900 0.000
subependymal giant cell astrocytoma -4.401 0.005
lung carcinoma 2.300 0.000
Breast cancer 1.300 0.003
psoriasis -1.400 0.000

Synonym

Accession P49418 A4D1X8 A4D1X9 O43538 Q75MJ8 Q75MK5 Q75MM3 Q8N4G0
Symbols AMPH1

Gene

PDB

1KY7   1UTC   3SOG   4ATM  

Gene RIF (12)

PMID Text
26506308 We show that AMPH-1/BIN1 binds to nesprin and actin, as well as to the microtubule-binding protein CLIP170 in both species. We propose that BIN1 has a direct and evolutionarily conserved role in nuclear positioning, altered in myopathies.
25087559 It is a nerve protein and its autoantibody causes paraneoplastic neurological syndromes.
22975846 AMPH1 protein level is reduced in transgenic mouse brain proteins. in the brainstem of nontransgenic and terminally ill JNPL3 transgenic mice.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22331304 We propose that antibody-mediated amphiphysin deficiency may account for anxiety behavior in stiff person syndrome
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20214647 investigation of binding affinities of decapeptide ligands with amphiphysin SH3 domain using QSAR models
19669081 structure-based approach to prediction of peptide-binding behavior of SH3 domain of amphiphysin-1: statistical modeling
18814309 Analyses of Gaussian distribution models showed that diversified properties contribute to the interactions between the SH3 domain and of amphiphysin and peptides.
18206907 This study demonstrates that the analysis of the molecular interaction energy components between peptides and the SH3 domain can successfully characterize the binding interface.
More...

AA Sequence

MADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEAEGTRLQRELRGYLAAIKGM      1 - 70
QEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFHQKLVDGSLLTLDTYLGQFPDIKNRIAKRSR     71 - 140
KLVDYDSARHHLEALQSSKRKDESRISKAEEEFQKAQKVFEEFNVDLQEELPSLWSRRVGFYVNTFKNVS    141 - 210
SLEAKFHKEIAVLCHKLYEVMTKLGDQHADKAFTIQGAPSDSGPLRIAKTPSPPEEPSPLPSPTASPNHT    211 - 280
LAPASPAPARPRSPSQTRKGPPVPPLPKVTPTKELQQENIISFFEDNFVPEISVTTPSQNEVPEVKKEET    281 - 350
LLDLDFDPFKPEVTPAGSAGVTHSPMSQTLPWDLWTTSTDLVQPASGGSFNGFTQPQDTSLFTMQTDQSM    351 - 420
ICNLAESEQAPPTEPKAEEPLAAVTPAVGLDLGMDTRAEEPVEEAVIIPGADADAAVGTLVSAAEGAPGE    421 - 490
EAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVIPSVVIEPASNHEEEGENEIT    491 - 560
IGAEPKETTEDAAPPGPTSETPELATEQKPIQDPQPTPSAPAMGAADQLASAREASQELPPGFLYKVETL    561 - 630
HDFEAANSDELTLQRGDVVLVVPSDSEADQDAGWLVGVKESDWLQYRDLATYKGLFPENFTRRLD         631 - 695
//

Text Mined References (54)

PMID Year Title
26506308 2015 Amphiphysin 2 Orchestrates Nucleus Positioning and Shape by Linking the Nuclear Envelope to the Actin and Microtubule Cytoskeleton.
25416956 2014 A proteome-scale map of the human interactome network.
25087559 2014 [Anti-amphiphysin antibody-positive paraneoplastic neurological syndrome with a longitudinally extensive spinal cord lesion of the dorsal column].
22975846 2012 Amphiphysin-1 protein level changes associated with tau-mediated neurodegeneration.
22750946 2012 External push and internal pull forces recruit curvature-sensing N-BAR domain proteins to the plasma membrane.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22331304 2012 Human IgG directed against amphiphysin induces anxiety behavior in a rat model after intrathecal passive transfer.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20946875 2010 Intersectin 1 forms complexes with SGIP1 and Reps1 in clathrin-coated pits.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...