Property Summary

NCBI Gene PubMed Count 53
PubMed Score 440.29
PubTator Score 74.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -2.500 1.2e-05
astrocytic glioma -3.000 1.2e-03
Astrocytoma, Pilocytic -1.900 1.6e-07
atypical teratoid / rhabdoid tumor -2.900 2.5e-06
Breast cancer 1.300 3.2e-03
cystic fibrosis 1.239 4.8e-05
ependymoma -3.800 2.4e-03
glioblastoma -2.300 1.7e-07
lung carcinoma 2.300 2.1e-19
medulloblastoma -1.300 2.1e-04
medulloblastoma, large-cell -3.800 2.3e-05
oligodendroglioma -2.100 1.4e-02
osteosarcoma 2.581 1.5e-02
primitive neuroectodermal tumor -1.700 1.4e-02
psoriasis -1.400 1.1e-44
subependymal giant cell astrocytoma -4.401 4.8e-03

 GO Function (1)

 GWAS Trait (1)

Protein-protein Interaction (8)

Gene RIF (12)

AA Sequence

MADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEAEGTRLQRELRGYLAAIKGM      1 - 70
QEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFHQKLVDGSLLTLDTYLGQFPDIKNRIAKRSR     71 - 140
KLVDYDSARHHLEALQSSKRKDESRISKAEEEFQKAQKVFEEFNVDLQEELPSLWSRRVGFYVNTFKNVS    141 - 210
SLEAKFHKEIAVLCHKLYEVMTKLGDQHADKAFTIQGAPSDSGPLRIAKTPSPPEEPSPLPSPTASPNHT    211 - 280
LAPASPAPARPRSPSQTRKGPPVPPLPKVTPTKELQQENIISFFEDNFVPEISVTTPSQNEVPEVKKEET    281 - 350
LLDLDFDPFKPEVTPAGSAGVTHSPMSQTLPWDLWTTSTDLVQPASGGSFNGFTQPQDTSLFTMQTDQSM    351 - 420
ICNLAESEQAPPTEPKAEEPLAAVTPAVGLDLGMDTRAEEPVEEAVIIPGADADAAVGTLVSAAEGAPGE    421 - 490
EAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVIPSVVIEPASNHEEEGENEIT    491 - 560
IGAEPKETTEDAAPPGPTSETPELATEQKPIQDPQPTPSAPAMGAADQLASAREASQELPPGFLYKVETL    561 - 630
HDFEAANSDELTLQRGDVVLVVPSDSEADQDAGWLVGVKESDWLQYRDLATYKGLFPENFTRRLD         631 - 695
//

Text Mined References (54)

PMID Year Title