Property Summary

NCBI Gene PubMed Count 33
Grant Count 150
R01 Count 113
Funding $26,030,836.85
PubMed Score 17.59
PubTator Score 247.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession P49411 O15276 EF-Tu
Symbols P43
EFTU
COXPD4
EF-TuMT

Gene

Gene RIF (9)

PMID Text
26781467 TUFM is a novel regulator of epithelial-mesenchymal transition (EMT); there may be a molecular link between mitochondrial dysfunction and EMT induction
23321557 NLRX1 and TUFM work in concert to reduce cytokine response and augment autophagy.
22944692 Positional proteomics analysis identifies the cleavage of human Tu translation elongation factor, mitochondrial (TUFM) at amino acid residues 81-82 and 149-150 by the HIV-1 protease
22772342 Increased expression of TUFM is a promising new prognostic indicator for colorectal carcinoma.
22749352 By recruiting Atg5-Atg12 and NLRX1, TUFM serves as a nodal checkpoint of the RIG-I-MAVS axis. It acts similarly to NLRX1 by inhibiting RigI-like-receptor-induced IFN-I but promoting autophagy.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19524667 Results suggest that the R336Q mutant mt-EFTu variant fails to bind to aminoacylated mitochondrial tRNAs, thus explaining the observed impairment of mitochondrial translation.
18753147 Myoblasts isolated from the MELAS patients show A3243G mutation in tRNALeu(UUR) produces a severe respiratory chain deficiency and this phenotype can be partially suppressed by overexpression of EFTu and EFG2.
17160893 Genetic investigation of patients with defective mitochondrial translation led to the discovery of novel mutations in the mitochondrial elongation factor G1 (EFG1) in one affected baby and in the mitochondrial elongation factor Tu (EFTu) in another one

AA Sequence

MAAATLLRATPHFSGLAAGRTFLLQGLLRLLKAPALPLLCRGLAVEAKKTYVRDKPHVNVGTIGHVDHGK      1 - 70
TTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITG     71 - 140
TAPLDGCILVVAANDGPMPQTREHLLLARQIGVEHVVVYVNKADAVQDSEMVELVELEIRELLTEFGYKG    141 - 210
EETPVIVGSALCALEGRDPELGLKSVQKLLDAVDTYIPVPARDLEKPFLLPVEAVYSVPGRGTVVTGTLE    211 - 280
RGILKKGDECELLGHSKNIRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSIKPHQ    281 - 350
KVEAQVYILSKEEGGRHKPFVSHFMPVMFSLTWDMACRIILPPEKELAMPGEDLKFNLILRQPMILEKGQ    351 - 420
RFTLRDGNRTIGTGLVTNTLAMTEEEKNIKWG                                          421 - 452
//

Text Mined References (39)

PMID Year Title
26781467 2016 TUFM downregulation induces epithelial-mesenchymal transition and invasion in lung cancer cells via a mechanism involving AMPK-GSK3? signaling.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23321557 2013 The NLR protein, NLRX1, and its partner, TUFM, reduce type I interferon, and enhance autophagy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22772342 2012 TUFM is a potential new prognostic indicator for colorectal carcinoma.
22749352 2012 The mitochondrial proteins NLRX1 and TUFM form a complex that regulates type I interferon and autophagy.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...