Property Summary

NCBI Gene PubMed Count 35
PubMed Score 21.10
PubTator Score 247.40

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (6)

Gene RIF (12)

AA Sequence

MAAATLLRATPHFSGLAAGRTFLLQGLLRLLKAPALPLLCRGLAVEAKKTYVRDKPHVNVGTIGHVDHGK      1 - 70
TTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITG     71 - 140
TAPLDGCILVVAANDGPMPQTREHLLLARQIGVEHVVVYVNKADAVQDSEMVELVELEIRELLTEFGYKG    141 - 210
EETPVIVGSALCALEGRDPELGLKSVQKLLDAVDTYIPVPARDLEKPFLLPVEAVYSVPGRGTVVTGTLE    211 - 280
RGILKKGDECELLGHSKNIRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSIKPHQ    281 - 350
KVEAQVYILSKEEGGRHKPFVSHFMPVMFSLTWDMACRIILPPEKELAMPGEDLKFNLILRQPMILEKGQ    351 - 420
RFTLRDGNRTIGTGLVTNTLAMTEEEKNIKWG                                          421 - 452
//

Text Mined References (41)

PMID Year Title