Property Summary

NCBI Gene PubMed Count 176
Grant Count 250
R01 Count 162
Funding $19,330,784.4
PubMed Score 366.31
PubTator Score 314.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
astrocytic glioma -1.200 0.039
ependymoma -2.200 0.005
osteosarcoma -3.563 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
glioblastoma -1.100 0.003
medulloblastoma, large-cell -1.600 0.000
adrenocortical carcinoma -1.036 0.004
tuberculosis 2.200 0.000
non-small cell lung cancer -2.655 0.000
lung cancer -2.800 0.000
lung adenocarcinoma -1.600 0.000
pediatric high grade glioma -1.100 0.001
pilocytic astrocytoma -1.100 0.000
inflammatory breast cancer -1.200 0.032
lung carcinoma -1.800 0.000
ductal carcinoma in situ -1.200 0.001
invasive ductal carcinoma -1.200 0.010
ulcerative colitis -1.100 0.000
ovarian cancer -1.500 0.000

Synonym

Accession P49407 B6V9G8 O75625 O75630 Q2PP20 Q9BTK8
Symbols ARB1
ARR1

Gene

PANTHER Protein Class (1)

PDB

2IV8  

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
504490 screening 1061 / 0 / 337539 Assay for Inhibitors of the beta-Arrestin-Adaptor Protein 2 Interaction That Mediate GPCR Degradation and Recycling
504493 summary 0 / 0 / 0 Summary of MLP Assay for Arrestin-AP2 Inhibitors
504541 screening 49 / 0 / 1924 Assay for Inhibitors of the beta-Arrestin-Adaptor Protein 2 Interaction for Validation Set
504908 screening 25 / 0 / 1321 Assay for Inhibitors of the beta-Arrestin-Adaptor Protein 2 Interaction for Cherry Pick 1
588338 other 21 / 0 / 1315 Counter Screen of assay for Inhibitors of the beta-Arrestin-Adaptor Protein 2 Interaction for Cherry Pick 1
588783 confirmatory 14 / 0 / 11 Dose Response Assay for Inhibitors of the beta-Arrestin-Adaptor Protein 2 Interaction for Cherry Pick 1

Gene RIF (114)

PMID Text
26708616 The nuclear accumulation of beta-arrestin 1 following TLR2 activation promote H4 acetylation at specific target gene promoters and may thus affect transcription of target genes in BM CD34+ cells.
26449263 beta-arrestins regulate oxidative stress in a Nox4-dependent manner and increase fibrosis in heart failure.
26347956 The identified receptor-phospho-selective mechanism for arrestin conformation and the spacing of the multiple phosphate-binding sites in the arrestin enable arrestin to recognize plethora phosphorylation states of numerous GPCRs.
26269596 analysis of how NK1 receptor Gs versus Gq proteins and beta-arrestin signaling is determined by interactions in the water hydrogen bond network
26211463 beta-arrestins functional involvement in myogenesis is presented.
26119788 These results indicated that b-arr1 regulated ER stress/PUMA-induced mucosal epithelial apoptosis through suppression of the TNF-a/p65/iNOS signaling pathway activation and that b-arr1 is a potential therapeutic target for Portal hypertensive gastropathy.
26097560 We conclude that beta-arrestin1 had a high expression in lung adenocarcinoma and beta-arrestin1 may be a promising biomarker to identify individuals with poor prognosis for patients with lung adenocarcinoma.
26077142 Data suggest that ARRB1 enhances hepatocellular carcinogenesis by inflammation-mediated Akt signaling.
25820700 Multivariate analysis using the Cox regression model confirmed that co-expression of nuclear beta-arrestin1 and p65 was an independent prognostic factor for tumor progression (p = 0.008
25766502 Bradykinin stimulates pro-contractile signalling mechanisms in human myometrial cells and arrestin proteins play key roles in their regulation.
More...

AA Sequence

MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDV      1 - 70
LGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKAC     71 - 140
GVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYH    141 - 210
GEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLAN    211 - 280
NREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFT    281 - 350
LMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR      351 - 418
//

Text Mined References (194)

PMID Year Title
26927499 2016 Contributions of protein kinases and ?-arrestin to termination of protease-activated receptor 2 signaling.
26708616 2016 Apoptosis in human myelodysplastic syndrome CD34+ cells is modulated by the upregulation of TLRs and histone H4 acetylation via a ?-arrestin 1 dependent mechanism.
26449263 2015 Regulation of mitochondrial oxidative stress by ?-arrestins in cultured human cardiac fibroblasts.
26347956 2015 Phospho-selective mechanisms of arrestin conformations and functions revealed by unnatural amino acid incorporation and (19)F-NMR.
26269596 2015 Biased Gs versus Gq proteins and ?-arrestin signaling in the NK1 receptor determined by interactions in the water hydrogen bond network.
26211463 2016 ?-Arrestin scaffolds and signaling elements essential for the obestatin/GPR39 system that determine the myogenic program in human myoblast cells.
26119788 2015 ?-Arrestin-1 protects against endoplasmic reticulum stress/p53-upregulated modulator of apoptosis-mediated apoptosis via repressing p-p65/inducible nitric oxide synthase in portal hypertensive gastropathy.
26097560 2015 ?-arrestin1 over-expression is associated with an unfavorable prognosis in lung adenocarcinomas and correlated with vascular endothelial growth factor.
26077142 2015 ?-Arrestin1 enhances hepatocellular carcinogenesis through inflammation-mediated Akt signalling.
25820700 2015 Co-expression of ?-arrestin1 and NF-?B is associated with cancer progression and poor prognosis in lung adenocarcinoma.
More...