Property Summary

NCBI Gene PubMed Count 196
PubMed Score 418.55
PubTator Score 314.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adrenocortical carcinoma -1.036 3.7e-03
astrocytic glioma -1.200 3.9e-02
atypical teratoid / rhabdoid tumor -1.200 2.5e-07
Breast cancer -1.200 1.0e-05
ductal carcinoma in situ -1.200 1.4e-03
ependymoma -2.200 5.5e-03
glioblastoma -1.100 2.7e-03
invasive ductal carcinoma -1.200 1.0e-02
lung adenocarcinoma -1.100 6.6e-10
lung cancer -1.400 1.9e-02
lung carcinoma -1.800 2.0e-27
malignant mesothelioma 1.500 1.8e-05
medulloblastoma, large-cell -1.600 1.6e-04
non-small cell lung cancer -1.327 8.8e-16
osteosarcoma -1.283 1.3e-03
ovarian cancer -1.500 8.9e-05
pediatric high grade glioma -1.100 8.1e-04
Pilocytic astrocytoma -1.100 2.6e-05
tuberculosis 1.400 2.2e-07
ulcerative colitis -1.100 1.4e-04

Gene RIF (131)

AA Sequence

MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDV      1 - 70
LGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKAC     71 - 140
GVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYH    141 - 210
GEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLAN    211 - 280
NREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFT    281 - 350
LMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR      351 - 418
//

Text Mined References (214)

PMID Year Title