Property Summary

NCBI Gene PubMed Count 18
PubMed Score 8.14
PubTator Score 8.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis 1.400 0.013
osteosarcoma -1.053 0.003
non-small cell lung cancer 1.053 0.000
lung cancer 2.600 0.001
active Crohn's disease 1.562 0.009
Breast cancer 2.500 0.039
aldosterone-producing adenoma -1.541 0.007
nasopharyngeal carcinoma 1.100 0.002
ovarian cancer 2.000 0.003
dermatomyositis 1.100 0.001

Synonym

Accession P49406 Q53TX9 Q96Q52 L19mt
Symbols RLX1
L19mt
MRPL15
RPML15
MRP-L15
MRP-L19

Gene

PDB

3J9M   3J7Y  

Gene RIF (7)

PMID Text
25448322 MRPL19 was initially implicated in dyslexia through family-based studies.
23954868 study failed to show any association of MRPL19 SNPs with developmental dyslexia in an Indian population.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20846247 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17309879 Observational study of gene-disease association. (HuGE Navigator)
17309879 Study refined the 2p12 candidate region in two populations and report evidence supporting MRPL19 and C2ORF3 as candidate susceptibility genes for dyslexia.

AA Sequence

MAACIAAGHWAAMGLGRSFQAARTLLPPPASIACRVHAGPVRQQSTGPSEPGAFQPPPKPVIVDKHRPVE      1 - 70
PERRFLSPEFIPRRGRTDPLKFQIERKDMLERRKVLHIPEFYVGSILRVTTADPYASGKISQFLGICIQR     71 - 140
SGRGLGATFILRNVIEGQGVEICFELYNPRVQEIQVVKLEKRLDDSLLYLRDALPEYSTFDVNMKPVVQE    141 - 210
PNQKVPVNELKVKMKPKPWSKRWERPNFNIKGIRFDLCLTEQQMKEAQKWNQPWLEFDMMREYDTSKIEA    211 - 280
AIWKEIEASKRS                                                              281 - 292
//

Text Mined References (21)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25448322 2015 Language impairment and dyslexia genes influence language skills in children with autism spectrum disorders.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
23954868 2013 Lack of association between genetic polymorphisms in ROBO1, MRPL19/C2ORF3 and THEM2 with developmental dyslexia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21844884 2013 Genome-wide meta-analysis identifies variants associated with platinating agent susceptibility across populations.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20846247 2011 Analysis of dyslexia candidate genes in the Raine cohort representing the general Australian population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...