Property Summary

NCBI Gene PubMed Count 30
Grant Count 113
R01 Count 45
Funding $18,905,059.13
PubMed Score 143.41
PubTator Score 56.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.202 0.029
Multiple myeloma 2.575 0.000
acute quadriplegic myopathy 1.509 0.000
non-small cell lung cancer 1.034 0.000
lung cancer 2.900 0.000
colon cancer 1.200 0.000
diabetes mellitus 2.100 0.001
ductal carcinoma in situ 1.100 0.001
invasive ductal carcinoma 1.300 0.002
ovarian cancer 3.400 0.000
dermatomyositis 1.100 0.004

Synonym

Accession P49368 A6NE14 Q5SZY1 Q9BR64 TCP-1-gamma
Symbols CCTG
PIG48
TRIC5
CCT-gamma
TCP-1-gamma

Gene

PANTHER Protein Class (2)

 MGI Term (1)

Gene RIF (7)

PMID Text
26739059 Suggest that CCT3 is indispensible for hepatocellular carcinoma cell proliferation, and provides a potential drug target for treatment of HCC.
26229401 Overexpression of CCT3 in the nuclei of cancerous cells is associated with hepatocellular carcinoma progression. CCT3 may be a target that affects the activation of STAT3 in HCC.
23868055 Expression of S100A9 and CCTgamma was significantly elevated in liver tissue of patients with cholangiocarcinoma compared with controls.
22399500 Our results implicate a novel cell signaling loop in HCt116 cells involving p53 and TCP1-gamma phosphorylation, which may be related to regulation and action of centrosomes.
20634891 Observational study of gene-disease association. (HuGE Navigator)
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
12586295 Among ten hepatocellular carcinoma cases with amplicon 1q21-q22, significant gene expression level of JTB, SHC1, CCT3 and COPA in the tumors than the paired adjacent non-malignant liver tissues.

AA Sequence

MMGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREI      1 - 70
QVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLKKI     71 - 140
SIPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRKEIDIKKYARVEKIPGGIIE    141 - 210
DSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCE    211 - 280
DIIQLKPDVVITEKGISDLAQHYLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLL    281 - 350
EIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAH    351 - 420
ALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQENCETWGVNGETGTLVDM    421 - 490
KELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQGGAPDAGQE                   491 - 545
//

Text Mined References (43)

PMID Year Title
26739059 2016 Molecular chaperone CCT3 supports proper mitotic progression and cell proliferation in hepatocellular carcinoma cells.
26229401 2015 Overexpression of chaperonin containing TCP1, subunit 3 predicts poor prognosis in hepatocellular carcinoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25467444 2014 Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.
25416956 2014 A proteome-scale map of the human interactome network.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24647736 2014 Multiple nonglycemic genomic loci are newly associated with blood level of glycated hemoglobin in East Asians.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23868055 2013 A prospective proteomic-based study for identifying potential biomarkers for the diagnosis of cholangiocarcinoma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
More...