Property Summary

NCBI Gene PubMed Count 31
PubMed Score 153.26
PubTator Score 56.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
acute quadriplegic myopathy 1.509 2.8e-08
colon cancer 1.200 5.9e-05
dermatomyositis 1.100 4.3e-03
diabetes mellitus 2.100 1.3e-03
ductal carcinoma in situ 1.100 1.3e-03
invasive ductal carcinoma 1.300 1.9e-03
lung cancer 2.900 2.6e-04
Multiple myeloma 2.575 9.8e-05
non-small cell lung cancer 1.034 8.4e-22
ovarian cancer 3.400 8.1e-07
Waldenstrons macroglobulinemia 1.202 2.9e-02

 MGI Phenotype (1)

Gene RIF (8)

AA Sequence

MMGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREI      1 - 70
QVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLKKI     71 - 140
SIPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRKEIDIKKYARVEKIPGGIIE    141 - 210
DSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCE    211 - 280
DIIQLKPDVVITEKGISDLAQHYLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLL    281 - 350
EIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAH    351 - 420
ALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQENCETWGVNGETGTLVDM    421 - 490
KELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQGGAPDAGQE                   491 - 545
//

Text Mined References (45)

PMID Year Title