Property Summary

NCBI Gene PubMed Count 39
PubMed Score 85.37
PubTator Score 170.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
acute myeloid leukemia -1.100 3.3e-02
diabetes mellitus -1.400 1.4e-03
Multiple myeloma 1.036 1.8e-02
osteosarcoma -1.457 2.1e-06
pancreatic ductal adenocarcinoma liver m... -1.125 4.2e-03
psoriasis -1.100 7.8e-04
subependymal giant cell astrocytoma -1.493 5.1e-03

Gene RIF (9)

AA Sequence

MEGSLEREAPAGALAAVLKHSSTLPPESTQVRGYDFNRGVNYRALLEAFGTTGFQATNFGRAVQQVNAMI      1 - 70
EKKLEPLSQDEDQHADLTQSRRPLTSCTIFLGYTSNLISSGIRETIRYLVQHNMVDVLVTTAGGVEEDLI     71 - 140
KCLAPTYLGEFSLRGKELRENGINRIGNLLVPNENYCKFEDWLMPILDQMVMEQNTEGVKWTPSKMIARL    141 - 210
GKEINNPESVYYWAQKNHIPVFSPALTDGSLGDMIFFHSYKNPGLVLDIVEDLRLINTQAIFAKCTGMII    211 - 280
LGGGVVKHHIANANLMRNGADYAVYINTAQEFDGSDSGARPDEAVSWGKIRVDAQPVKVYADASLVFPLL    281 - 350
VAETFAQKMDAFMHEKNED                                                       351 - 369
//

Text Mined References (46)

PMID Year Title