Property Summary

NCBI Gene PubMed Count 36
Grant Count 114
R01 Count 68
Funding $19,015,359.34
PubMed Score 85.42
PubTator Score 170.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.036 0.018
psoriasis -1.100 0.001
osteosarcoma -1.457 0.000
pancreatic ductal adenocarcinoma liver m... -1.125 0.004
diabetes mellitus -1.400 0.001
subependymal giant cell astrocytoma -1.707 0.005
acute myeloid leukemia -1.100 0.033

Synonym

Accession P49366 A8K688 M0R1I5 Q13184 Q13276 Q9UDG0 DHS
Symbols DS
DHS
MIG13

Gene

PDB

1DHS   1RLZ   1ROZ   1RQD  

Gene RIF (8)

PMID Text
25511211 Whereas, dhps mutation study revealed that triple mutant haplotype AGEAA (S436A+A437G+K540E) associated with Sulphadoxine resistance was found among 26% of P. falciparum field isolates.
22927971 eIF-5A as well as the hypusine-forming enzymes deoxyhypusine synthase (DHS) and deoxyhypusine hydroxylase (DOHH) are highly overexpressed in glioblastoma patient sample
22491477 DHPS and WDR83 were capable of forming an RNA duplex at overlapping 3' untranslated regions and this duplex increased their mutual stability, which was required for the bidirectional regulation.
20439316 A novel series of cell movements that orient the polarity of Lrp12/Mig13a-expressing neurons and their axons just prior to cortical plate assembly do not occur in reeler mutant mice.
19055622 Dhps-437 and dhps-540 are strongly associated with SP treatment failure and should be evaluated further as a method for surveillance of SP-based therapy in DRC.
15100216 crystal structure of deoxyhypusine synthase reveals the configuration of the active enzyme and of an enzyme.NAD.inhibitor ternary complex
14749535 deoxyhypusine synthase and its phosphorylation modification may have other independent cellular functions because of versatile roles of deoxyhypusine synthase
12788913 deoxyhypusine synthase has a role in generating spermidine or homospermidine

AA Sequence

MEGSLEREAPAGALAAVLKHSSTLPPESTQVRGYDFNRGVNYRALLEAFGTTGFQATNFGRAVQQVNAMI      1 - 70
EKKLEPLSQDEDQHADLTQSRRPLTSCTIFLGYTSNLISSGIRETIRYLVQHNMVDVLVTTAGGVEEDLI     71 - 140
KCLAPTYLGEFSLRGKELRENGINRIGNLLVPNENYCKFEDWLMPILDQMVMEQNTEGVKWTPSKMIARL    141 - 210
GKEINNPESVYYWAQKNHIPVFSPALTDGSLGDMIFFHSYKNPGLVLDIVEDLRLINTQAIFAKCTGMII    211 - 280
LGGGVVKHHIANANLMRNGADYAVYINTAQEFDGSDSGARPDEAVSWGKIRVDAQPVKVYADASLVFPLL    281 - 350
VAETFAQKMDAFMHEKNED                                                       351 - 369
//

Text Mined References (43)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25511211 Genetic polymorphisms associated with sulphadoxine-pyrimethamine drug resistance among Plasmodium falciparum field isolates in malaria endemic areas of Assam.
25416956 2014 A proteome-scale map of the human interactome network.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23525104 2013 Allosteric activation of trypanosomatid deoxyhypusine synthase by a catalytically dead paralog.
22927971 2012 Expression of eukaryotic initiation factor 5A and hypusine forming enzymes in glioblastoma patient samples: implications for new targeted therapies.
22491477 2012 Bidirectional regulation between WDR83 and its natural antisense transcript DHPS in gastric cancer.
21269460 2011 Initial characterization of the human central proteome.
20439316 2011 Lrp12/Mig13a reveals changing patterns of preplate neuronal polarity during corticogenesis that are absent in reeler mutant mice.
More...