Property Summary

NCBI Gene PubMed Count 35
Grant Count 11
R01 Count 11
Funding $521,325.71
PubMed Score 7.43
PubTator Score 3.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Familial partial lipodystrophy 7 3.125 1.6

Expression

Gene RIF (5)

PMID Text
23643986 The results of this study show that activation in Ras signaling cascade may be implicated in the METH-induced death signaling pathway in neuroblastoma SH-SY5Y cells.
22992747 Data show that protein farnesyltransferase (FTase) specificity can be "tuned" using a small number of active site contacts that play essential roles in discriminating against non-substrates in the wild-type enzyme.
22882915 The level of FTase mRNA expression in cancer tissues is much higher than in normal tissues. FTase may play an important role in the genesis and development of PLC and may be one of the markers for the metastatic activity gained by liver tumor cells.
19841875 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11751396 farnesyl:protein transferase and geranylgeranyl:protein transferase inhibitor combinations in preclinical models.

AA Sequence

MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPR      1 - 70
LVLQREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPEGGF     71 - 140
GGGPGQYPHLAPTYAAVNALCIIGTEEAYDIINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASV    141 - 210
ASLTNIITPDLFEGTAEWIARCQNWEGGIGGVPGMEAHGGYTFCGLAALVILKRERSLNLKSLLQWVTSR    211 - 280
QMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGDPALSMSHWMFHQQALQEYILMCCQCPAGGL    281 - 350
LDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDVVLGVPENALQPTHPVYNIGPDKVIQATTYFLQKPV    351 - 420
PGFEELKDETSAEPATD                                                         421 - 437
//

Text Mined References (39)

PMID Year Title
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23643986 2013 Farnesyltransferase inhibitor attenuates methamphetamine toxicity-induced Ras proteins activation and cell death in neuroblastoma SH-SY5Y cells.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
22992747 2012 Expansion of protein farnesyltransferase specificity using "tunable" active site interactions: development of bioengineered prenylation pathways.
22882915 2012 Expression of farnesyltransferase in primary liver cancer.
21269460 2011 Initial characterization of the human central proteome.
19862010 2009 Multiple loci influence erythrocyte phenotypes in the CHARGE Consortium.
19841875 2010 Polymorphisms of the lamina maturation pathway and their association with the metabolic syndrome: the DESIR prospective study.
19246009 2009 Structural basis for binding and selectivity of antimalarial and anticancer ethylenediamine inhibitors to protein farnesyltransferase.
19228685 2009 The protein farnesyltransferase regulates HDAC6 activity in a microtubule-dependent manner.
More...