Property Summary

NCBI Gene PubMed Count 33
PubMed Score 23.49
PubTator Score 13.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.494 0.004
Multiple myeloma 1.017 0.009
osteosarcoma 1.579 0.000
diabetes mellitus 2.200 0.005
acute myeloid leukemia 2.400 0.031
ovarian cancer -1.400 0.000
pituitary cancer -1.200 0.000
Down syndrome 1.300 0.000

Synonym

Accession P49354 A6NJW0 Q53XJ9 Q9UDC1
Symbols FPTA
PTAR2
PGGT1A

Gene

PANTHER Protein Class (2)

PDB

1JCQ   1LD7   1LD8   1MZC   1S63   1SA4   1TN6   2F0Y   2H6F   2H6G   2H6H   2H6I   2IEJ   3E37  

Gene RIF (9)

PMID Text
22160308 our findings identify Geranylgeranyl transferase 1 as a key regulator of human airway smooth muscle cell viability
20403997 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19841875 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19228685 FTase, via its tubulin-association, is a critical upstream regulator of HDAC6 activity
18406652 Geranylgeranyltransferase-1 modulates both p24CA release and intracellular Gag in TNF-alpha-stimulated U1 cells
18406652 Geranylgeranyltransferase-1 modulates both p24CA release and intracellular Gag in TNF-alpha-stimulated U1 cells
18187620 Knockdown of farnesyltransferase, CAAX box, alpha (FNTA) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17192483 Geranylgeranyltransferase inhibitor-2147 (GGTI-2147), an inhibitor of protein prenylation, elicited significant inhibition of glucose-stimulated insulin secretion from INS 832/13 islet cells.
15451670 Results suggest that all peptide substrates adopt a common binding mode in the protein farnesyltransferase and geranylgeranyltransferase active site.

AA Sequence

MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYRDRA      1 - 70
EWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVL     71 - 140
LKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVI    141 - 210
QEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYL    211 - 280
KGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDT    281 - 350
IRKEYWRYIGRSLQSKHSTENDSPTNVQQ                                             351 - 379
//

Text Mined References (42)

PMID Year Title
22160308 2012 Geranylgeranyl transferase 1 modulates autophagy and apoptosis in human airway smooth muscle.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20403997 2010 Genetic variation in 3-hydroxy-3-methylglutaryl CoA reductase modifies the chemopreventive activity of statins for colorectal cancer.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19841875 2010 Polymorphisms of the lamina maturation pathway and their association with the metabolic syndrome: the DESIR prospective study.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19246009 2009 Structural basis for binding and selectivity of antimalarial and anticancer ethylenediamine inhibitors to protein farnesyltransferase.
19228685 2009 The protein farnesyltransferase regulates HDAC6 activity in a microtubule-dependent manner.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...