Property Summary

NCBI Gene PubMed Count 73
Grant Count 66
R01 Count 33
Funding $5,751,669.3
PubMed Score 102.73
PubTator Score 72.98

Knowledge Summary

Patent (13,721)

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis -1.300 0.000
osteosarcoma -4.264 0.000
group 4 medulloblastoma 1.600 0.003
medulloblastoma, large-cell 1.700 0.000
adrenocortical carcinoma 1.095 0.044
intraductal papillary-mucinous neoplasm ... 1.200 0.029
lung cancer 2.400 0.002
subependymal giant cell astrocytoma -1.874 0.001
ovarian cancer -1.100 0.002
Breast cancer 1.300 0.001
pituitary cancer 1.100 0.013

Synonym

Accession P49336 Q5VUF3 Q6ISB5
Symbols K35

Gene

PDB

3RGF   4CRL   4F6S   4F6U   4F6W   4F70   4F7J   4F7L   4F7N   4F7S   4G6L   5BNJ   5CEI   5FGK   5HBE   5HBH   5HBJ   5HNB   5HVY   5I5Z  

  TechDev Info (2)

Gary Johnson Kinome profile via MIB/MS Technology
Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (46)

PMID Text
26496706 Collectively, our results implicate Ste12 and Tec1 as general and important contributors to the Cdk8, RNAPII-CTD regulatory circuitry as it relates to the maintenance of genome integrity
26452386 the expression of CDK8 and its interactive genes has a profound impact on the response to adjuvant therapy in breast cancer in accordance with the role of CDK8 in chemotherapy-induced tumor-supporting paracrine activities--{REVIEW}
26416749 Mediator-associated kinases CDK8 and CDK19 restrain increased activation of key super-enhancer-associated genes in acute myeloid leukaemia (AML) cells
26349978 our data provided evidence that CDK-8 played a significant role in colon cancer hepatic metastasis by regulating the Wnt/beta-catenin signal pathway
26286725 miR-101 is a potent tumor repressor that directly represses CDK8 expression
26182352 Data suggest that MED13, MED12, CDK8 and cyclin C (CycC) comprise a four-subunit "kinase" module of the Mediator complex that functions as a major ingress of oncogenic and developmental signaling/gene expression in humans. [REVIEW]
26042770 our results suggest that mTORC1 activation in NAFLD and insulin resistance results in down-regulation of the CDK8-CycC complex and elevation of lipogenic protein expression.
26006748 Current state of the art confirms that further development of CDK8 inhibitors will translate into targeted therapies in oncology
26002960 Data suggest that, during neurogenesis, Mediator complex cyclin-dependent kinases (CDK8, CDK19) interact directly with PRC2 (polycomb repressive complex 2) subunit EZH2 (enhancer of zeste homolog 2), as well as SUZ12 (suppressor of zeste 12 homolog).
25818643 The Skp2-mH2A1-CDK8 axis has a critical role in breast cancer development via dysregulation of the G2/M transition, polyploidy, cell growth dysregulation, and loss of tumor suppression.
More...

AA Sequence

MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALL      1 - 70
RELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIH     71 - 140
YLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARH    141 - 210
YTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLM    211 - 280
KDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQ    281 - 350
IPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTS    351 - 420
DYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY                              421 - 464
//

Text Mined References (79)

PMID Year Title
26678610 2016 Transcriptional kinases: Less is more (or less).
26496706 2015 The RNAPII-CTD Maintains Genome Integrity through Inhibition of Retrotransposon Gene Expression and Transposition.
26452386 2015 Expression of CDK8 and CDK8-interacting Genes as Potential Biomarkers in Breast Cancer.
26416749 2015 Mediator kinase inhibition further activates super-enhancer-associated genes in AML.
26349978 2015 Downregulation of CDK-8 inhibits colon cancer hepatic metastasis by regulating Wnt/?-catenin pathway.
26286725 2015 MicroRNA-101 is a potential prognostic indicator of laryngeal squamous cell carcinoma and modulates CDK8.
26182352 2015 Mediator kinase module and human tumorigenesis.
26042770 2015 mTORC1 Down-Regulates Cyclin-Dependent Kinase 8 (CDK8) and Cyclin C (CycC).
26006748 2015 CDK8 kinase--An emerging target in targeted cancer therapy.
26002960 2015 Mediator complex cooperatively regulates transcription of retinoic acid target genes with Polycomb Repressive Complex 2 during neuronal differentiation.
More...