Property Summary

Ligand Count 96
NCBI Gene PubMed Count 79
PubMed Score 117.24
PubTator Score 72.98

Knowledge Summary

Patent (13,721)

Expression

  Differential Expression (11)

Disease log2 FC p
adrenocortical carcinoma 1.095 4.4e-02
Breast cancer 1.300 1.0e-03
group 3 medulloblastoma 1.500 4.8e-02
intraductal papillary-mucinous neoplasm ... 1.200 2.9e-02
lung cancer 2.400 1.7e-03
medulloblastoma, large-cell 1.600 6.3e-04
osteosarcoma -4.264 1.1e-09
ovarian cancer -1.100 1.7e-03
pituitary cancer 1.100 1.3e-02
psoriasis -1.300 3.8e-04
subependymal giant cell astrocytoma -1.874 1.2e-03

PDB (25)

Gene RIF (50)

AA Sequence

MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALL      1 - 70
RELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIH     71 - 140
YLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARH    141 - 210
YTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLM    211 - 280
KDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQ    281 - 350
IPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTS    351 - 420
DYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY                              421 - 464
//

Text Mined References (85)

PMID Year Title