Property Summary

NCBI Gene PubMed Count 38
PubMed Score 184.70
PubTator Score 139.47

Knowledge Summary

Patent

No data available

Gene RIF (25)

AA Sequence

MATAASNPYSILSSTSLVHADSAGMQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSST      1 - 70
LATSPLDQQDVKPGREDLQLGAIIHHRSPHVAHHSPHTNHPNAWGASPAPNPSITSSGQPLNVYSQPGFT     71 - 140
VSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDHSDEETPTSDELEQFAKQFKQRRIKLGF    141 - 210
TQADVGLALGTLYGNVFSQTTICRFEGLQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRK    211 - 280
KRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGDQQPHEVYSH    281 - 350
TVKTDTSCHDL                                                               351 - 361
//

Text Mined References (38)

PMID Year Title