Property Summary

NCBI Gene PubMed Count 24
PubMed Score 10.41
PubTator Score 24.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 2.0e-03
Breast cancer -2.000 1.7e-05
colon cancer -1.300 2.0e-02
cutaneous lupus erythematosus -1.300 1.2e-02
esophageal adenocarcinoma 1.500 3.6e-02
interstitial cystitis -1.800 5.4e-04
interstitial lung disease -1.600 2.9e-02
intraductal papillary-mucinous adenoma (... 3.000 2.3e-05
intraductal papillary-mucinous carcinoma... 1.200 1.7e-02
intraductal papillary-mucinous neoplasm ... 1.300 2.0e-02
lung adenocarcinoma -1.200 4.7e-04
lung cancer -1.900 8.7e-04
lung carcinoma -1.200 4.2e-04
nasopharyngeal carcinoma -1.100 2.6e-07
non-small cell lung cancer -1.820 2.1e-10
pancreatic ductal adenocarcinoma liver m... -1.997 6.1e-04
pituitary cancer -1.200 7.7e-03
psoriasis -1.100 2.2e-05
tuberculosis 1.200 6.7e-05
ulcerative colitis -1.379 2.5e-02

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (7)

AA Sequence

MTKKRIAVIGGGVSGLSSIKCCVEEGLEPVCFERTDDIGGLWRFQENPEEGRASIYKSVIINTSKEMMCF      1 - 70
SDYPIPDHYPNFMHNAQVLEYFRMYAKEFDLLKYIRFKTTVCSVKKQPDFATSGQWEVVTESEGKKEMNV     71 - 140
FDGVMVCTGHHTNAHLPLESFPGIEKFKGQYFHSRDYKNPEGFTGKRVIIIGIGNSGGDLAVEISQTAKQ    141 - 210
VFLSTRRGAWILNRVGDYGYPADVLFSSRLTHFIWKICGQSLANKYLEKKINQRFDHEMFGLKPKHRALS    211 - 280
QHPTLNDDLPNRIISGLVKVKGNVKEFTETAAIFEDGSREDDIDAVIFATGYSFDFPFLEDSVKVVKNKI    281 - 350
SLYKKVFPPNLERPTLAIIGLIQPLGAIMPISELQGRWATQVFKGLKTLPSQSEMMAEISKAQEEIDKRY    351 - 420
VESQRHTIQGDYIDTMEELADLVGVRPNLLSLAFTDPKLALHLLLGPCTPIHYRVQGPGKWDGARKAILT    421 - 490
TDDRIRKPLMTRVVERSSSMTSTMTIGKFMLALAFFAIIIAYF                               491 - 533
//

Text Mined References (26)

PMID Year Title