Property Summary

Ligand Count 623
NCBI Gene PubMed Count 139
PubMed Score 100.57
PubTator Score 153.09

Knowledge Summary

Patent (1,026)

Expression

 MGI Phenotype (1)

Gene RIF (132)

AA Sequence

MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLLVILSVLRNRK      1 - 70
LRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVMGLSVIGSVFNITAIAINRYC     71 - 140
YICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGSLEYDPRIYSCTFIQTASTQYTAAVVVIHFL    141 - 210
LPIAVVSFCYLRIWVLVLQARRKAKPESRLCLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQE    211 - 280
MAPQIPEGLFVTSYLLAYFNSCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAP    281 - 350
PIIGVQHQADAL                                                              351 - 362
//

Text Mined References (139)

PMID Year Title