Property Summary

NCBI Gene PubMed Count 130
Grant Count 3
R01 Count 1
Funding $606,684.5
PubMed Score 92.38
PubTator Score 153.09

Knowledge Summary

Patent (1,026)

Synonym

Accession P49286 Mel-1B-R
Symbols MT2
FGQTL2
MEL-1B-R

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

 MGI Term (1)

Gene RIF (123)

PMID Text
26551672 Increases in islet MTNR1B expression is associated with type 2 diabetes susceptibility.
26519818 rs10830963 polymorphism was not associated with polycystic ovary syndrome in Han Chinese.
26440713 MTNR1B rs10830963 risk variant worsens the effect of melatonin on glucose tolerance
26431121 This systematic review was a comprehensive analysis of the currently available evidence, and found an overall significant association of rs4753426 polymorphism with the risk of--{REVIEW}
26345809 Authors investigated the association between rs4753426 single nucleotide polymorphisms in the melatonin receptor 1B (MTNR1B) gene and the risk of developing gestational diabetes mellitus (GDM).
25982863 Carriers of the G allele of MTNR1B rs10830963 are more likely to develop gestational diabetes than carriers of the C allele.
25939854 results indicate, for the first time, the presence of a functional circadian clock in the human myometrium with the hMTNR1B gene as a clock controlled target.
25922310 results obtained are suggestive of MTNR1B role in T2D etiology, they need to be confirmed with much larger sample sizes
25919927 It has been shown for the first time in obese youth that the MTNR1B variant is associated with an increased risk of IFG
25898821 MTNR1B rs4753426 and MTNR1B rs10830963 polymorphisms are not obviously associated with risk of AIS in either Asian populations or Caucasian populations.
More...

AA Sequence

MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLLVILSVLRNRK      1 - 70
LRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVMGLSVIGSVFNITAIAINRYC     71 - 140
YICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGSLEYDPRIYSCTFIQTASTQYTAAVVVIHFL    141 - 210
LPIAVVSFCYLRIWVLVLQARRKAKPESRLCLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQE    211 - 280
MAPQIPEGLFVTSYLLAYFNSCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAP    281 - 350
PIIGVQHQADAL                                                              351 - 362
//

Text Mined References (130)

PMID Year Title
26551672 2015 Genetic fine mapping and genomic annotation defines causal mechanisms at type 2 diabetes susceptibility loci.
26519818 2015 Family association study between melatonin receptor gene polymorphisms and polycystic ovary syndrome in Han Chinese.
26514267 2016 Protein interactome mining defines melatonin MT1 receptors as integral component of presynaptic protein complexes of neurons.
26440713 2015 Common type 2 diabetes risk variant in MTNR1B worsens the deleterious effect of melatonin on glucose tolerance in humans.
26431121 The Association of rs4753426 Polymorphism in the Melatonin Receptor 1B (MTNR1B) Gene and Susceptibility to Adolescent Idiopathic Scoliosis: A Systematic Review and Meta-analysis.
26345809 2015 Association between the rs4753426 polymorphism in MTNR1B with fasting plasma glucose level and pancreatic ?-cell function in gestational diabetes mellitus.
25982863 2015 The MTNR1B gene polymorphism rs10830963 is associated with gestational diabetes in a Brazilian population.
25939854 2015 Circadian clock regulation of melatonin MTNR1B receptor expression in human myometrial smooth muscle cells.
25922310 2015 MTNR1B gene polymorphisms and susceptibility to Type 2 Diabetes: A pilot study in South Indians.
25919927 2015 A common variant in the MTNR1b gene is associated with increased risk of impaired fasting glucose (IFG) in youth with obesity.
More...