Property Summary

NCBI Gene PubMed Count 91
Grant Count 176
R01 Count 101
Funding $16,292,438.19
PubMed Score 352.16
PubTator Score 237.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -2.600 0.000
psoriasis 1.200 0.000
osteosarcoma -2.095 0.000
glioblastoma 1.400 0.000
medulloblastoma, large-cell -1.200 0.000
tuberculosis -1.200 0.000
colon cancer 1.600 0.005
pediatric high grade glioma 1.100 0.000
lung adenocarcinoma 1.488 0.000
invasive ductal carcinoma 1.100 0.048
ovarian cancer 2.300 0.000

Synonym

Accession P49281 B3KT08 B4DK84 F5H741 O43288 O60932 O94801 Q498Z5 Q8IUD7 Q96J35 NRAMP 2
Symbols DCT1
DMT1
AHMIO1
NRAMP2

Gene

PANTHER Protein Class (2)

Gene RIF (66)

PMID Text
26289753 These data suggest that iron uptake induces the production of ROS, which modify DMT1 endocytic cycling, thus changing the iron transport activity at the apical membrane.
26067577 Gene silencing of either CTR1 or DMT1 did not affect copper accumulation in cells, but deficiency in both CTR1 and DMT1 resulted in a complete inhibition of copper uptake.
25817364 the TT genotype and T allele of the 1254T>C polymorphism may be a risk factor for Parkinson disease
25772431 Suggest role for divalent cation transporter DMT1 in the entry of Hg(II) into the intestinal epithelium.
25562168 We propose that DMT1 deficiency negatively affects metabolism and life span of mature erythrocytes; two other aspects of defective erythropoiesis which contribute to the pathophysiology of the disease
24914374 Six months after RYGB surgery, patients exhibit an increase in DMT1 expression in the enterocytes of the tips of the villi at the proximal jejunum
24742347 HIV-1 and the viral protein Tat modulate the expression of solute carrier family 11, member 2 (SLC11A2; proton-coupled divalent metal ion transporter) in immature dendritic
24475238 In Parkinson's disease, increased iron levels are associated with increased Ndfip1 expression for the regulation of DMT1, including abnormal Ndfip1 activation in non-neuronal cell types such as astrocytes.
24448823 DMT1 not only exports iron from endosomes, but also serves to import the metal into the mitochondria
24120082 The DMT1 IVS4 C(+) allele occurred more frequently in WND than in the healthy controls.
More...

AA Sequence

MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCFSFRKL      1 - 70
WAFTGPGFLMSIAYLDPGNIESDLQSGAVAGFKLLWILLLATLVGLLLQRLAARLGVVTGLHLAEVCHRQ     71 - 140
YPKVPRVILWLMVELAIIGSDMQEVIGSAIAINLLSVGRIPLWGGVLITIADTFVFLFLDKYGLRKLEAF    141 - 210
FGFLITIMALTFGYEYVTVKPSQSQVLKGMFVPSCSGCRTPQIEQAVGIVGAVIMPHNMYLHSALVKSRQ    211 - 280
VNRNNKQEVREANKYFFIESCIALFVSFIINVFVVSVFAEAFFGKTNEQVVEVCTNTSSPHAGLFPKDNS    281 - 350
TLAVDIYKGGVVLGCYFGPAALYIWAVGILAAGQSSTMTGTYSGQFVMEGFLNLKWSRFARVVLTRSIAI    351 - 420
IPTLLVAVFQDVEHLTGMNDFLNVLQSLQLPFALIPILTFTSLRPVMSDFANGLGWRIAGGILVLIICSI    421 - 490
NMYFVVVYVRDLGHVALYVVAAVVSVAYLGFVFYLGWQCLIALGMSFLDCGHTCHLGLTAQPELYLLNTM    491 - 560
DADSLVSR                                                                  561 - 568
//

Text Mined References (95)

PMID Year Title
26289753 2015 Iron-induced reactive oxygen species mediate transporter DMT1 endocytosis and iron uptake in intestinal epithelial cells.
26067577 2015 Copper uptake by DMT1: a compensatory mechanism for CTR1 deficiency in human umbilical vein endothelial cells.
25817364 2015 Is the 1254T>C polymorphism in the DMT1 gene associated with Parkinson's disease?
25772431 2015 Participation of divalent cation transporter DMT1 in the uptake of inorganic mercury.
25562168 2014 DMT1-mutant erythrocytes have shortened life span, accelerated glycolysis and increased oxidative stress.
25491917 2015 Inhibition of iron uptake by ferristatin II is exerted through internalization of DMT1 at the plasma membrane.
25326704 2014 Crystal structure of a SLC11 (NRAMP) transporter reveals the basis for transition-metal ion transport.
24914374 2014 Changes in iron transporter divalent metal transporter 1 in proximal jejunum after gastric bypass.
24475238 2014 Increased Ndfip1 in the substantia nigra of Parkinsonian brains is associated with elevated iron levels.
24448823 2014 Evidence for mitochondrial localization of divalent metal transporter 1 (DMT1).
More...