Property Summary

Ligand Count 30
NCBI Gene PubMed Count 98
PubMed Score 373.46
PubTator Score 237.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
colon cancer 1.300 1.1e-02
glioblastoma 1.400 1.7e-05
invasive ductal carcinoma 1.100 4.8e-02
lung adenocarcinoma 1.488 7.0e-06
malignant mesothelioma -2.600 1.4e-07
medulloblastoma, large-cell -1.200 3.2e-05
osteosarcoma -1.367 2.2e-03
ovarian cancer 1.400 8.3e-05
pediatric high grade glioma 1.100 2.1e-06
psoriasis 1.200 2.5e-04
tuberculosis -1.200 4.5e-05

Gene RIF (71)

AA Sequence

MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCFSFRKL      1 - 70
WAFTGPGFLMSIAYLDPGNIESDLQSGAVAGFKLLWILLLATLVGLLLQRLAARLGVVTGLHLAEVCHRQ     71 - 140
YPKVPRVILWLMVELAIIGSDMQEVIGSAIAINLLSVGRIPLWGGVLITIADTFVFLFLDKYGLRKLEAF    141 - 210
FGFLITIMALTFGYEYVTVKPSQSQVLKGMFVPSCSGCRTPQIEQAVGIVGAVIMPHNMYLHSALVKSRQ    211 - 280
VNRNNKQEVREANKYFFIESCIALFVSFIINVFVVSVFAEAFFGKTNEQVVEVCTNTSSPHAGLFPKDNS    281 - 350
TLAVDIYKGGVVLGCYFGPAALYIWAVGILAAGQSSTMTGTYSGQFVMEGFLNLKWSRFARVVLTRSIAI    351 - 420
IPTLLVAVFQDVEHLTGMNDFLNVLQSLQLPFALIPILTFTSLRPVMSDFANGLGWRIAGGILVLIICSI    421 - 490
NMYFVVVYVRDLGHVALYVVAAVVSVAYLGFVFYLGWQCLIALGMSFLDCGHTCHLGLTAQPELYLLNTM    491 - 560
DADSLVSR                                                                  561 - 568
//

Text Mined References (101)

PMID Year Title