Property Summary

NCBI Gene PubMed Count 165
Grant Count 134
R01 Count 88
Funding $21,755,556.77
PubMed Score 594.07
PubTator Score 310.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
sarcoidosis -1.400 0.006
psoriasis -1.100 0.003
glioblastoma 1.700 0.013
osteosarcoma -2.649 0.000
tuberculosis and treatment for 6 months -1.800 0.000
non-small cell lung cancer -2.208 0.000
lung cancer -3.300 0.000
pancreatic cancer 1.200 0.001
group 3 medulloblastoma -1.100 0.018
lung carcinoma -3.000 0.000
mucosa-associated lymphoid tissue lympho... 1.441 0.006

Synonym

Accession P49279 C0H5Y3 NRAMP 1
Symbols LSH
NRAMP
NRAMP1

Gene

PANTHER Protein Class (2)

Gene RIF (202)

PMID Text
27069153 No significant difference was found for NRAMP1 and hGPX1 gene polymorphisms associated with recurrence time.
26814595 The 274C/T polymorphism in exon 3 and the 469+14G/C polymorphism in intron 4 of the Slc11a1/Nramp1 gene were associated with susceptibility to leprosy, while the allele 2 and 3 of the (GT)n polymorphism in the promoter region were associated with susceptibility and protection to leprosy, respectively.
26658322 The ratio of FoxA1 to FoxA2 in lung adenocarcinoma is regulated by LncRNA HOTAIR and chromatin remodeling factor LSH
26578819 NRAMP1 3'UTR variants were associated with susceptibility to M. tuberculosis infection.
26353180 genetic association studies in population in Mexico: Data suggest an SNP in SLC11A1 (D543N, G/A genotype) is associated with treatment failure (after treatment with combinations of antitubercular agents) in male patients with pulmonary tuberculosis.
26281177 Study results have demonstrated, that of all investigated polymorphic variants of genes IL4 (C-590T), IL4RA (150V), TNF (G-308A) and SLC11A1 (D543N) in patients with chronic liver diseases of various etiology
26261060 investigation of NRAMP1, MBL, MBL, VDR gene polymorphisms and their interaction with susceptibility to pulmonary tuberculosis in a Chinese population; study suggests that genotypes of many polymorphic genes are associated with TB
26055722 Nramp1 expression is up-regulated by cytokines, and its function helps to produce nitric oxide along with other pro-inflammatory responses. [Review]
25856512 Genetic variants of SLC11A1 are associated with both autoimmune and infectious diseases.
25603101 SLC11A1 gene polymorphisms might have a relevant role in the pathology of leishmaniasis, directing towards susceptibility outcome of this disease
More...

AA Sequence

MTGDKGPQRLSGSSYGSISSPTSPTSPGPQQAPPRETYLSEKIPIPDTKPGTFSLRKLWAFTGPGFLMSI      1 - 70
AFLDPGNIESDLQAGAVAGFKLLWVLLWATVLGLLCQRLAARLGVVTGKDLGEVCHLYYPKVPRTVLWLT     71 - 140
IELAIVGSDMQEVIGTAIAFNLLSAGRIPLWGGVLITIVDTFFFLFLDNYGLRKLEAFFGLLITIMALTF    141 - 210
GYEYVVARPEQGALLRGLFLPSCPGCGHPELLQAVGIVGAIIMPHNIYLHSALVKSREIDRARRADIREA    211 - 280
NMYFLIEATIALSVSFIINLFVMAVFGQAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDIYQGGV    281 - 350
ILGCLFGPAALYIWAIGLLAAGQSSTMTGTYAGQFVMEGFLRLRWSRFARVLLTRSCAILPTVLVAVFRD    351 - 420
LRDLSGLNDLLNVLQSLLLPFAVLPILTFTSMPTLMQEFANGLLNKVVTSSIMVLVCAINLYFVVSYLPS    421 - 490
LPHPAYFGLAALLAAAYLGLSTYLVWTCCLAHGATFLAHSSHHHFLYGLLEEDQKGETSG              491 - 550
//

Text Mined References (167)

PMID Year Title
27069153 2016 Predictive Value of NRAMP1 and HGPX1 Gene Polymorphism for Maintenance BCG Response in Non-muscle-invasive Bladder Cancer.
26814595 2016 Association of the solute carrier family 11 member 1 gene polymorphisms with susceptibility to leprosy in a Brazilian sample.
26658322 2015 The ratio of FoxA1 to FoxA2 in lung adenocarcinoma is regulated by LncRNA HOTAIR and chromatin remodeling factor LSH.
26578819 2015 NRAMP1 and VDR Gene Polymorphisms in Susceptibility to Tuberculosis in Venezuelan Population.
26353180 2015 The D543N polymorphism of the SLC11A1/NRAMP1 gene is associated with treatment failure in male patients with pulmonary tuberculosis.
26281177 2015 [IMMUNOGENETICS AND PROGRESSION OF CHRONIC VIRAL HEPATITES].
26261060 2015 An association study of NRAMP1, VDR, MBL and their interaction with the susceptibility to tuberculosis in a Chinese population.
26055722 2015 Nramp1 and Other Transporters Involved in Metal Withholding during Infection.
25856512 2015 Genetic variants of SLC11A1 are associated with both autoimmune and infectious diseases: systematic review and meta-analysis.
25603101 2015 Association of leishmaniasis with TNF alpha promoter and SLC11A1 gene polymorphisms in patients of two endemic areas in Mexico.
More...