Property Summary

NCBI Gene PubMed Count 176
PubMed Score 629.27
PubTator Score 310.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Juvenile rheumatoid arthritis 111 0.0 5.0

Expression

  Differential Expression (11)

Disease log2 FC p
tuberculosis -1.200 2.6e-03
sarcoidosis -1.400 6.0e-03
glioblastoma 1.700 1.3e-02
group 3 medulloblastoma -1.100 1.8e-02
lung cancer -2.000 1.4e-04
lung carcinoma -3.000 1.8e-27
mucosa-associated lymphoid tissue lympho... 1.441 6.4e-03
non-small cell lung cancer -2.208 6.1e-21
osteosarcoma -2.091 1.4e-06
pancreatic cancer 1.200 9.0e-04
psoriasis -1.100 2.9e-03

Gene RIF (212)

AA Sequence

MTGDKGPQRLSGSSYGSISSPTSPTSPGPQQAPPRETYLSEKIPIPDTKPGTFSLRKLWAFTGPGFLMSI      1 - 70
AFLDPGNIESDLQAGAVAGFKLLWVLLWATVLGLLCQRLAARLGVVTGKDLGEVCHLYYPKVPRTVLWLT     71 - 140
IELAIVGSDMQEVIGTAIAFNLLSAGRIPLWGGVLITIVDTFFFLFLDNYGLRKLEAFFGLLITIMALTF    141 - 210
GYEYVVARPEQGALLRGLFLPSCPGCGHPELLQAVGIVGAIIMPHNIYLHSALVKSREIDRARRADIREA    211 - 280
NMYFLIEATIALSVSFIINLFVMAVFGQAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDIYQGGV    281 - 350
ILGCLFGPAALYIWAIGLLAAGQSSTMTGTYAGQFVMEGFLRLRWSRFARVLLTRSCAILPTVLVAVFRD    351 - 420
LRDLSGLNDLLNVLQSLLLPFAVLPILTFTSMPTLMQEFANGLLNKVVTSSIMVLVCAINLYFVVSYLPS    421 - 490
LPHPAYFGLAALLAAAYLGLSTYLVWTCCLAHGATFLAHSSHHHFLYGLLEEDQKGETSG              491 - 550
//

Text Mined References (178)

PMID Year Title