Property Summary

NCBI Gene PubMed Count 77
PubMed Score 270.69
PubTator Score 132.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.000 3.6e-06
Breast cancer 2.300 2.8e-02
ependymoma 1.200 1.7e-02
Gaucher disease type 1 -1.700 2.7e-02
glioblastoma 1.700 4.5e-03
group 4 medulloblastoma 1.900 4.8e-05
invasive ductal carcinoma 1.100 1.1e-02
lung cancer 1.200 2.8e-02
medulloblastoma, large-cell 3.200 4.0e-07
non-small cell lung cancer 1.179 4.6e-12
osteosarcoma 4.300 1.4e-05
pancreatic ductal adenocarcinoma liver m... -1.999 4.6e-04
pediatric high grade glioma 1.200 7.5e-03

Gene RIF (64)

AA Sequence

MAGSRQRGLRARVRPLFCALLLSLGRFVRGDGVGGDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHA      1 - 70
GNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGS     71 - 140
ADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQN    141 - 210
TLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKE    211 - 280
ISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNR    281 - 350
QLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGM    351 - 420
QHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLSTVHFIIFVVVQTV    421 - 490
LFIGYIMYRSQQEAAAKKFF                                                      491 - 510
//

Text Mined References (82)

PMID Year Title