Property Summary

NCBI Gene PubMed Count 72
Grant Count 42
R01 Count 27
Funding $4,860,760.51
PubMed Score 270.83
PubTator Score 132.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (65)

PMID Text
26150355 MMP-9 secretion was reduced in the LMAN1 knockout cell line compared to control cells confirming the functional role of LMAN1.
25664598 Mannan-binding lectin reduces CpG DNA-induced inflammatory cytokine production in monocytes.
24237698 Authors identified a class of pathogen-derived ERGIC-53 ligands, a lectin-independent basis for their association with ERGIC-53, and a role for ERGIC-53 in the propagation of several highly pathogenic RNA virus families.
23852824 Studies indicate that the LMAN1-CRD contains distinct, separable binding sites for both its partner protein MCFD2 and the cargo proteins FV/FVIII.
23709226 Data indicate that together with its soluble coreceptor MCFD2, LMAN1 transports coagulation factors V (FV) and VIII (FVIII).
22764119 Mutations in LMAN1 lead to F5F8D (combined deficiency of factor V And factor VIII) due to alterations in LMAN1-MCFD2 complex of coat protein (COP)II complex trafficking machinery; 70% of F5F8D patients have mutations in LMAN1. [REVIEW]
22337587 UBXD1 modulates the trafficking of ERGIC-53-containing vesicles by controlling the interaction of transport factors with the cytoplasmic tail of ERGIC-53.
22190034 HIV-1 gp160 is identified to have a physical interaction with lectin, mannose-binding 1 (LMAN1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22190034 HIV-1 gp160 is identified to have a physical interaction with lectin, mannose-binding 1 (LMAN1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MAGSRQRGLRARVRPLFCALLLSLGRFVRGDGVGGDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHA      1 - 70
GNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGS     71 - 140
ADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQN    141 - 210
TLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKE    211 - 280
ISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNR    281 - 350
QLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGM    351 - 420
QHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLSTVHFIIFVVVQTV    421 - 490
LFIGYIMYRSQQEAAAKKFF                                                      491 - 510
//

Text Mined References (78)

PMID Year Title
26150355 2015 LMAN1 (ERGIC-53) is a potential carrier protein for matrix metalloproteinase-9 glycoprotein secretion.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25664598 2015 Mannan-binding lectin reduces CpG DNA-induced inflammatory cytokine production by human monocytes.
24806965 2014 TMEM115 is an integral membrane protein of the Golgi complex involved in retrograde transport.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24237698 2013 The intracellular cargo receptor ERGIC-53 is required for the production of infectious arenavirus, coronavirus, and filovirus particles.
23852824 2013 Combined deficiency of coagulation factors V and VIII: an update.
23709226 2013 Structural characterization of carbohydrate binding by LMAN1 protein provides new insight into the endoplasmic reticulum export of factors V (FV) and VIII (FVIII).
22764119 2013 Inherited hematological disorders due to defects in coat protein (COP)II complex.
22337587 2012 Protein interaction profiling of the p97 adaptor UBXD1 points to a role for the complex in modulating ERGIC-53 trafficking.
More...