Property Summary

NCBI Gene PubMed Count 72
PubMed Score 270.83
PubTator Score 132.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
non-small cell lung cancer 2798 1.47924523252616E-10
medulloblastoma, large-cell 6234 3.95696545229348E-7
ependymoma 2514 3.52755333996284E-6
atypical teratoid / rhabdoid tumor 4369 3.62673673487932E-6
osteosarcoma 7933 1.3584454306893E-5
group 4 medulloblastoma 1875 4.76099939834973E-5
pancreatic ductal adenocarcinoma liver metastasis 1795 4.60051774325495E-4
glioblastoma 5572 0.00446590811857384
pediatric high grade glioma 2712 0.00745343789816971
invasive ductal carcinoma 2950 0.0112974368729375
Gaucher disease type 1 171 0.0271804570882315
Breast cancer 3099 0.0277289402518278
lung cancer 4473 0.0281814894868084

Expression

  Differential Expression (13)

Synonym

Accession P49257 Q12895 Q8N5I7 Q9UQG1 Q9UQG2 Q9UQG3 Q9UQG4 Q9UQG5 Q9UQG6 Q9UQG7 Q9UQG8 Q9UQG9 Q9UQH0 Q9UQH1 Q9UQH2
Symbols MR60
gp58
F5F8D
FMFD1
MCFD1
ERGIC53
ERGIC-53

Gene

PANTHER Protein Class (1)

PDB

3A4U   3LCP   3WHT   3WHU   3WNX   4GKX   4GKY   4YGB   4YGC   4YGD   4YGE  

  Ortholog (14)

Gene RIF (62)

PMID Text
26150355 MMP-9 secretion was reduced in the LMAN1 knockout cell line compared to control cells confirming the functional role of LMAN1.
25664598 Mannan-binding lectin reduces CpG DNA-induced inflammatory cytokine production in monocytes.
24237698 Authors identified a class of pathogen-derived ERGIC-53 ligands, a lectin-independent basis for their association with ERGIC-53, and a role for ERGIC-53 in the propagation of several highly pathogenic RNA virus families.
23852824 Studies indicate that the LMAN1-CRD contains distinct, separable binding sites for both its partner protein MCFD2 and the cargo proteins FV/FVIII.
23709226 Data indicate that together with its soluble coreceptor MCFD2, LMAN1 transports coagulation factors V (FV) and VIII (FVIII).
22764119 Mutations in LMAN1 lead to F5F8D (combined deficiency of factor V And factor VIII) due to alterations in LMAN1-MCFD2 complex of coat protein (COP)II complex trafficking machinery; 70% of F5F8D patients have mutations in LMAN1. [REVIEW]
22337587 UBXD1 modulates the trafficking of ERGIC-53-containing vesicles by controlling the interaction of transport factors with the cytoplasmic tail of ERGIC-53.
22190034 HIV-1 gp160 is identified to have a physical interaction with lectin, mannose-binding 1 (LMAN1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20460353 Two new mutations at ERGIC-53 gene in a Turkish family.
More...

AA Sequence

MAGSRQRGLRARVRPLFCALLLSLGRFVRGDGVGGDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHA      1 - 70
GNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGS     71 - 140
ADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQN    141 - 210
TLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKE    211 - 280
ISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNR    281 - 350
QLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGM    351 - 420
QHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLSTVHFIIFVVVQTV    421 - 490
LFIGYIMYRSQQEAAAKKFF                                                      491 - 510
//

Text Mined References (78)

PMID Year Title
26150355 2015 LMAN1 (ERGIC-53) is a potential carrier protein for matrix metalloproteinase-9 glycoprotein secretion.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25664598 2015 Mannan-binding lectin reduces CpG DNA-induced inflammatory cytokine production by human monocytes.
24806965 2014 TMEM115 is an integral membrane protein of the Golgi complex involved in retrograde transport.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24237698 2013 The intracellular cargo receptor ERGIC-53 is required for the production of infectious arenavirus, coronavirus, and filovirus particles.
23852824 2013 Combined deficiency of coagulation factors V and VIII: an update.
23709226 2013 Structural characterization of carbohydrate binding by LMAN1 protein provides new insight into the endoplasmic reticulum export of factors V (FV) and VIII (FVIII).
22764119 2013 Inherited hematological disorders due to defects in coat protein (COP)II complex.
22337587 2012 Protein interaction profiling of the p97 adaptor UBXD1 points to a role for the complex in modulating ERGIC-53 trafficking.
More...