Property Summary

NCBI Gene PubMed Count 17
Grant Count 55
R01 Count 13
Funding $19,364,208.49
PubMed Score 750.26
PubTator Score 25.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.225 0.034
malignant mesothelioma 1.800 0.000
osteosarcoma -1.090 0.021
group 3 medulloblastoma 1.500 0.000

Gene RIF (7)

PMID Text
26248089 CRC cells that overexpressed miR124 or with knockdown of RPIA or PRPS1 had reduced DNA synthesis and proliferation, whereas cells incubated with an inhibitor of miR124 had significantly increased DNA synthesis and proliferation and formed more colonies.
25528729 In this work, through an in silico comparative analysis between the genomes of Leishmania major and Homo sapiens, the enzyme ribose 5-phosphate isomerase (R5PI) was indicated as a promising molecular target.
25429733 Study provides new insight into the molecular mechanisms by which RPIA overexpression can induce oncogenesis in hepatocellular carcinoma.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
14988808 RPI is the second known inborn error in the reversible phase of the pentose-phosphate-pathway, confirming that defects in pentose and polyol metabolism constitute a new area of inborn metabolic disorders

AA Sequence

MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSGTRGGAGNTSTSCGDSNSICP      1 - 70
APSTMSKAEEAKKLAGRAAVENHVRNNQVLGIGSGSTIVHAVQRIAERVKQENLNLVCIPTSFQARQLIL     71 - 140
QYGLTLSDLDRHPEIDLAIDGADEVDADLNLIKGGGGCLTQEKIVAGYASRFIVIADFRKDSKNLGDQWH    141 - 210
KGIPIEVIPMAYVPVSRAVSQKFGGVVELRMAVNKAGPVVTDNGNFILDWKFDRVHKWSEVNTAIKMIPG    211 - 280
VVDTGLFINMAERVYFGMQDGSVNMREKPFC                                           281 - 311
//

Text Mined References (20)

PMID Year Title
26248089 2015 MicroRNA-124 reduces the pentose phosphate pathway and proliferation by targeting PRPS1 and RPIA mRNAs in human colorectal cancer cells.
25528729 2015 Structural modeling and docking studies of ribose 5-phosphate isomerase from Leishmania major and Homo sapiens: a comparative analysis for Leishmaniasis treatment.
25429733 2015 Ribose-5-phosphate isomerase A regulates hepatocarcinogenesis via PP2A and ERK signaling.
25416956 2014 A proteome-scale map of the human interactome network.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...