Property Summary

NCBI Gene PubMed Count 20
PubMed Score 771.53
PubTator Score 25.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.500 8.0e-05
malignant mesothelioma 1.800 1.7e-06
osteosarcoma -1.090 2.1e-02
Waldenstrons macroglobulinemia 1.225 3.4e-02

Synonym

Accession P49247 Q541P9 Q96BJ6
Symbols RPI
RPIAD

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

AA Sequence

MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSGTRGGAGNTSTSCGDSNSICP      1 - 70
APSTMSKAEEAKKLAGRAAVENHVRNNQVLGIGSGSTIVHAVQRIAERVKQENLNLVCIPTSFQARQLIL     71 - 140
QYGLTLSDLDRHPEIDLAIDGADEVDADLNLIKGGGGCLTQEKIVAGYASRFIVIADFRKDSKNLGDQWH    141 - 210
KGIPIEVIPMAYVPVSRAVSQKFGGVVELRMAVNKAGPVVTDNGNFILDWKFDRVHKWSEVNTAIKMIPG    211 - 280
VVDTGLFINMAERVYFGMQDGSVNMREKPFC                                           281 - 311
//

Text Mined References (23)

PMID Year Title