Tbio | Ribose-5-phosphate isomerase |
The protein encoded by this gene is an enzyme, which catalyzes the reversible conversion between ribose-5-phosphate and ribulose-5-phosphate in the pentose-phosphate pathway. This gene is highly conserved in most organisms. The enzyme plays an essential role in the carbohydrate metabolism. Mutations in this gene cause ribose 5-phosphate isomerase deficiency. A pseudogene is found on chromosome 18. [provided by RefSeq, Mar 2010]
Comments
Disease | Target Count |
---|---|
Ribose 5-phosphate isomerase deficiency | 1 |
Disease | Target Count | P-value |
---|---|---|
malignant mesothelioma | 3163 | 1.70424406347944E-6 |
group 3 medulloblastoma | 2254 | 8.00990786577148E-5 |
osteosarcoma | 7933 | 0.0205413873152006 |
Waldenstrons macroglobulinemia | 765 | 0.0335833229841524 |
Disease | Target Count |
---|---|
Ribose-5-P isomerase deficiency | 1 |
Disease | log2 FC | p |
---|---|---|
Waldenstrons macroglobulinemia | 1.225 | 0.034 |
malignant mesothelioma | 1.800 | 0.000 |
osteosarcoma | -1.090 | 0.021 |
group 3 medulloblastoma | 1.500 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG |
Horse | OMA EggNOG |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG Inparanoid |
Opossum | EggNOG Inparanoid |
Platypus | OMA EggNOG |
Chicken | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
Zebrafish | OMA EggNOG Inparanoid |
C. elegans | OMA EggNOG Inparanoid |
S.cerevisiae | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
26248089 | CRC cells that overexpressed miR124 or with knockdown of RPIA or PRPS1 had reduced DNA synthesis and proliferation, whereas cells incubated with an inhibitor of miR124 had significantly increased DNA synthesis and proliferation and formed more colonies. |
25528729 | In this work, through an in silico comparative analysis between the genomes of Leishmania major and Homo sapiens, the enzyme ribose 5-phosphate isomerase (R5PI) was indicated as a promising molecular target. |
25429733 | Study provides new insight into the molecular mechanisms by which RPIA overexpression can induce oncogenesis in hepatocellular carcinoma. |
20628086 | Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) |
20379614 | Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) |
19913121 | Observational study of gene-disease association. (HuGE Navigator) |
14988808 | RPI is the second known inborn error in the reversible phase of the pentose-phosphate-pathway, confirming that defects in pentose and polyol metabolism constitute a new area of inborn metabolic disorders |
MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSGTRGGAGNTSTSCGDSNSICP 1 - 70 APSTMSKAEEAKKLAGRAAVENHVRNNQVLGIGSGSTIVHAVQRIAERVKQENLNLVCIPTSFQARQLIL 71 - 140 QYGLTLSDLDRHPEIDLAIDGADEVDADLNLIKGGGGCLTQEKIVAGYASRFIVIADFRKDSKNLGDQWH 141 - 210 KGIPIEVIPMAYVPVSRAVSQKFGGVVELRMAVNKAGPVVTDNGNFILDWKFDRVHKWSEVNTAIKMIPG 211 - 280 VVDTGLFINMAERVYFGMQDGSVNMREKPFC 281 - 311 //
PMID | Year | Title |
---|---|---|
26248089 | 2015 | MicroRNA-124 reduces the pentose phosphate pathway and proliferation by targeting PRPS1 and RPIA mRNAs in human colorectal cancer cells. |
25528729 | 2015 | Structural modeling and docking studies of ribose 5-phosphate isomerase from Leishmania major and Homo sapiens: a comparative analysis for Leishmaniasis treatment. |
25429733 | 2015 | Ribose-5-phosphate isomerase A regulates hepatocarcinogenesis via PP2A and ERK signaling. |
25416956 | 2014 | A proteome-scale map of the human interactome network. |
24129315 | 2014 | Immunoaffinity enrichment and mass spectrometry analysis of protein methylation. |
23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
21516116 | 2011 | Next-generation sequencing to generate interactome datasets. |
21269460 | 2011 | Initial characterization of the human central proteome. |
20628086 | 2010 | Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. |
20379614 | Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. | |
More... |