Property Summary

Ligand Count 31
NCBI Gene PubMed Count 267
PubMed Score 609.68
PubTator Score 402.05

Knowledge Summary

Patent (32,486)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Age related macular degeneration 72 4.68 2.3

Expression

  Differential Expression (26)

Disease log2 FC p
astrocytoma 2.000 8.6e-03
Astrocytoma, Pilocytic 2.000 1.5e-04
atypical teratoid / rhabdoid tumor -2.700 2.4e-04
Breast cancer -3.400 4.0e-14
breast carcinoma -1.300 1.3e-14
chronic lymphosyte leukemia -1.200 1.3e-02
dermatomyositis 1.200 7.7e-03
gastric cancer 1.500 1.2e-02
group 3 medulloblastoma -3.600 1.0e-04
head and neck cancer -1.400 2.2e-02
hepatocellular carcinoma 2.000 2.8e-05
intraductal papillary-mucinous carcinoma... -1.900 5.0e-02
invasive ductal carcinoma 1.241 1.8e-02
lung adenocarcinoma -1.200 4.8e-09
lung cancer -1.500 3.8e-02
lung carcinoma -1.500 1.6e-07
medulloblastoma, large-cell -3.500 3.8e-05
nasopharyngeal carcinoma -1.100 1.4e-02
nephrosclerosis 1.993 2.1e-03
non-small cell lung cancer -3.007 2.1e-21
oligodendroglioma -1.100 1.0e-04
ovarian cancer -2.700 1.3e-05
pituitary cancer 3.600 1.3e-07
primary pancreatic ductal adenocarcinoma -1.205 5.5e-03
psoriasis 1.200 4.2e-07
tuberculosis 2.300 2.5e-04

Protein-protein Interaction (1)

Gene RIF (282)

AA Sequence

MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYL      1 - 70
LNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNN     71 - 140
RTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYC    141 - 210
YFRIIQTLFSCKNHKKAKAIKLILLVVIVFFLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTET    211 - 280
VAFSHCCLNPLIYAFAGEKFRRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGD    281 - 350
ALLLL                                                                     351 - 355
//

Text Mined References (271)

PMID Year Title