Property Summary

NCBI Gene PubMed Count 253
Grant Count 282
R01 Count 146
Funding $34,863,135.56
PubMed Score 554.66
PubTator Score 402.05

Knowledge Summary

Patent (32,486)

Expression

  Differential Expression (26)

Disease log2 FC p
nephrosclerosis 1.993 0.002
gastric cancer 1.500 0.012
hepatocellular carcinoma 2.000 0.000
oligodendroglioma -1.100 0.000
chronic lymphosyte leukemia -1.200 0.013
group 3 medulloblastoma -3.600 0.000
astrocytoma 2.000 0.009
atypical teratoid / rhabdoid tumor -2.700 0.000
medulloblastoma, large-cell -3.500 0.000
tuberculosis 2.300 0.000
primary pancreatic ductal adenocarcinoma -1.205 0.005
non-small cell lung cancer -3.007 0.000
intraductal papillary-mucinous carcinoma... -1.900 0.050
lung cancer -1.500 0.038
lung adenocarcinoma -1.900 0.000
pilocytic astrocytoma 2.000 0.000
invasive ductal carcinoma -1.700 0.048
nasopharyngeal carcinoma -1.100 0.014
psoriasis 1.200 0.000
Breast cancer -3.400 0.000
lung carcinoma -1.500 0.000
breast carcinoma -1.300 0.000
ovarian cancer -2.700 0.000
pituitary cancer 3.600 0.000
dermatomyositis 1.200 0.008
head and neck cancer -1.400 0.022

Synonym

Accession P49238 A0N0N6 B2R5Z4 J3KP17 C-X3-C CKR-1
Symbols V28
CCRL1
GPR13
CMKDR1
GPRV28
CMKBRL1

Gene

  TechDev Info (1)

Gene RIF (269)

PMID Text
26651305 This meta-analysis suggested that CX3CR1 T280M and V249I polymorphisms may not be associated with an increased risk of AMD based on current published data.
26633537 CX3CR1 is expressed in the normal, cancer adjacent normal, inflammatory, and malignant fallopian epithelium.
26464724 CX3CR1 T allele of rs3732379 might have a positive association with the susceptibility of age-related macular degeneration
26297201 Respiratory syncytial virus G protein and host CX3CR1 interaction is important in infection and infection-induced responses of the airway epithelium.
26276874 this is the first demonstration of the role of DNA methylation in regulating the expression of the CX3CR1 gene by CD8+ T cells and the potential biological relevance of increased expression of CX3CR1 by IL-7Ra(low) effector memory CD8+ T cells in humans.
26141368 The high expression of CX3CR1 was associated with prolonged isolated thrombocytopenia after allogeneic hematopoietic stem cell transplantation.
26123579 Association of hydrogen sulfide with alterations of monocyte chemokine receptors, CCR2 and CX3CR1 in patients with coronary artery disease
26107373 CX3CR1 is expressed in differentiated human ciliated airway cells and co-localizes with respiratory syncytial virus on cilia in a G protein-dependent manner.
26042517 Fractalkine receptor polymorphisms may not contribute to the molecular pathogenesis of ulcerative colitis.
25987130 Data show that fractalkine receptor CX3CR1 expression is decreased in both murine and human glioblastoma (GBM) tissue.
More...

AA Sequence

MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYL      1 - 70
LNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNN     71 - 140
RTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYC    141 - 210
YFRIIQTLFSCKNHKKAKAIKLILLVVIVFFLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTET    211 - 280
VAFSHCCLNPLIYAFAGEKFRRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGD    281 - 350
ALLLL                                                                     351 - 355
//

Text Mined References (257)

PMID Year Title
26651305 2015 Association of CX3CR1 (V249I and T280M) polymorphisms with age-related macular degeneration: a meta-analysis.
26633537 2015 Examination of the Fractalkine and Fractalkine Receptor Expression in Fallopian Adenocarcinoma Reveals Differences When Compared to Ovarian Carcinoma.
26464724 2015 CX3CR1 polymorphisms and the risk of age-related macular degeneration.
26297201 2015 CX3CR1 is an important surface molecule for respiratory syncytial virus infection in human airway epithelial cells.
26276874 2015 DNA Methylation Regulates the Differential Expression of CX3CR1 on Human IL-7R?low and IL-7R?high Effector Memory CD8+ T Cells with Distinct Migratory Capacities to the Fractalkine.
26141368 2015 Recruitment of CD8(+) T cells into bone marrow might explain the suppression of megakaryocyte apoptosis through high expression of CX3CR1(+) in prolonged isolated thrombocytopenia after allogeneic hematopoietic stem cell transplantation.
26123579 2015 Association of hydrogen sulfide with alterations of monocyte chemokine receptors, CCR2 and CX3CR1 in patients with coronary artery disease.
26107373 2015 CX3CR1 Is Expressed in Differentiated Human Ciliated Airway Cells and Co-Localizes with Respiratory Syncytial Virus on Cilia in a G Protein-Dependent Manner.
26042517 2015 Fractalkine receptor polymorphism may not be associated with the development and clinical course of ulcerative colitis.
25987130 2015 Loss of CX3CR1 increases accumulation of inflammatory monocytes and promotes gliomagenesis.
More...