Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.4e-18
ovarian cancer 8520 4.8e-09

Gene RIF (1)

AA Sequence

MQLQASLSFLLILTLCLELRSELARDTIKDLLPNVCAFPMEKGPCQTYMTRWFFNFETGECELFAYGGCG      1 - 70
GNSNNFLRKEKCEKFCKFT                                                        71 - 89
//

Text Mined References (5)

PMID Year Title