Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
ovarian cancer 8,484
psoriasis 6,685

Gene RIF (1)

PMID Text
17589793 Identifies genes on chromosome 20q12-13.1, including the gene encoding this kunitz domain-containing serine protease inhibitor.

AA Sequence

MQLQASLSFLLILTLCLELRSELARDTIKDLLPNVCAFPMEKGPCQTYMTRWFFNFETGECELFAYGGCG      1 - 70
GNSNNFLRKEKCEKFCKFT                                                        71 - 89
//

Text Mined References (5)

PMID Year Title
21988899 2011 Three genes expressing Kunitz domains in the epididymis are related to genes of WFDC-type protease inhibitors and semen coagulum proteins in spite of lacking similarity between their protein products.
20171287 2010 Voxelwise genome-wide association study (vGWAS).
17589793 2007 A locus on chromosome 20 encompassing genes that are highly expressed in the epididymis.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11549316 2001 A high-resolution 6.0-megabase transcript map of the type 2 diabetes susceptibility region on human chromosome 20.