Property Summary

NCBI Gene PubMed Count 23
PubMed Score 688.66
PubTator Score 547.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 2.100 0.002
acute myeloid leukemia -1.600 0.042

Synonym

Accession P49207 Q6FG66 Q9BUZ2
Symbols L34

Gene

PDB

4UG0   4V6X   5AJ0  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (4)

PMID Text
26526135 over-expressed RPL34 may promote malignant proliferation of NSCLC cells, thus playing an important role in development and progress of NSCLC
26362536 HIV-1 Gag interacts with RPL34 as demonstrated by proximity dependent biotinylation proteomics
20877624 Observational study of gene-disease association. (HuGE Navigator)
20332099 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKT      1 - 70
KKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQAQSQKAK                            71 - 117
//

Text Mined References (32)

PMID Year Title
26526135 2016 Over-expressed RPL34 promotes malignant proliferation of non-small cell lung cancer cells.
26323242 2015 RNAi-mediated RPL34 knockdown suppresses the growth of human gastric cancer cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
More...