Property Summary

NCBI Gene PubMed Count 23
PubMed Score 739.00
PubTator Score 547.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
acute myeloid leukemia -1.600 4.2e-02
diabetes mellitus 2.100 1.6e-03

Gene RIF (5)

AA Sequence

MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKT      1 - 70
KKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQAQSQKAK                            71 - 117
//

Text Mined References (34)

PMID Year Title