Property Summary

NCBI Gene PubMed Count 23
Grant Count 7
R01 Count 5
Funding $576,099
PubMed Score 688.66
PubTator Score 547.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 2.100 0.002
acute myeloid leukemia -1.600 0.042

Gene RIF (4)

PMID Text
26526135 over-expressed RPL34 may promote malignant proliferation of NSCLC cells, thus playing an important role in development and progress of NSCLC
26362536 HIV-1 Gag interacts with RPL34 as demonstrated by proximity dependent biotinylation proteomics
20877624 Observational study of gene-disease association. (HuGE Navigator)
20332099 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKT      1 - 70
KKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQAQSQKAK                            71 - 117
//

Text Mined References (32)

PMID Year Title
26526135 2016 Over-expressed RPL34 promotes malignant proliferation of non-small cell lung cancer cells.
26323242 2015 RNAi-mediated RPL34 knockdown suppresses the growth of human gastric cancer cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
More...