Property Summary

NCBI Gene PubMed Count 22
Grant Count 13
R01 Count 6
Funding $1,848,650.99
PubMed Score 27.11
PubTator Score 28.72

Knowledge Summary

Patent (2,494)

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -2.400 0.011
ependymoma -2.400 0.024
oligodendroglioma -2.100 0.020
atypical teratoid/rhabdoid tumor 1.100 0.019
Breast cancer -1.100 0.005
ovarian cancer 2.900 0.001

Gene RIF (9)

PMID Text
24378925 Variation in the PTH2R gene (Chr2q34, rs897083) may contribute to the age-associated degenerative manifestations that develop at the lumbar spine
23092913 Data suggest role for PTH2R signaling in postnatal growth plate development and subsequent bone mass acquisition; overexpression of human PTH2R in chondrocytes of transgenic mice has key consequences on postnatal development of endochondral skeleton.
21756942 PTH-receptors regulate norepinephrine release in human heart and kidney
19401215 The results demonstrate that TIP39 and the PTH2R are expressed in the brain of primates in locations that suggest involvement in regulation of fear, anxiety, reproductive behaviors, release of pituitary hormones, and nociception.
18539702 Different receptor subtype properties were used to demonstrate that residue 41 in PTH-1R, when either the native Leu or substituted by Ile or Met, can accommodate either Phe or Trp at position 23 of the ligand.
18459453 The distribution of PTH2R-immunoreactive fibers in viscerosensory brain regions is similar to that reported in mouse and rat suggesting a similar role of the PTH2R in human as in rodents.
18280230 6 SNPs in the PTH gene and 3 SNPs each in the PTHLH, PTHR1 and PTHR2 genes were investigated in relation to bone mineral density
18280230 Observational study of gene-disease association. (HuGE Navigator)
14988434 specific interactions within the ligand-receptor bimolecular complex mediate distinct postactivation responses of class II G protein- coupled receptors and provide novel insights into the physiological regulation of PTH2R activity

AA Sequence

MAGLGASLHVWGWLMLGSCLLARAQLDSDGTITIEEQIVLVLKAKVQCELNITAQLQEGEGNCFPEWDGL      1 - 70
ICWPRGTVGKISAVPCPPYIYDFNHKGVAFRHCNPNGTWDFMHSLNKTWANYSDCLRFLQPDISIGKQEF     71 - 140
FERLYVMYTVGYSISFGSLAVAILIIGYFRRLHCTRNYIHMHLFVSFMLRATSIFVKDRVVHAHIGVKEL    141 - 210
ESLIMQDDPQNSIEATSVDKSQYIGCKIAVVMFIYFLATNYYWILVEGLYLHNLIFVAFFSDTKYLWGFI    211 - 280
LIGWGFPAAFVAAWAVARATLADARCWELSAGDIKWIYQAPILAAIGLNFILFLNTVRVLATKIWETNAV    281 - 350
GHDTRKQYRKLAKSTLVLVLVFGVHYIVFVCLPHSFTGLGWEIRMHCELFFNSFQGFFVSIIYCYCNGEV    351 - 420
QAEVKKMWSRWNLSVDWKRTPPCGSRRCGSVLTTVTHSTSSQSQVAASTRMVLISGKAAKIASRQPDSHI    421 - 490
TLPGYVWSNSEQDCLPHSFHEETKEDSGRQGDDILMEKPSRPMESNPDTEGCQGETEDVL              491 - 550
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24378925 2015 Variation in the PTH2R gene is associated with age-related degenerative changes in the lumbar spine.
23092913 2012 Defective postnatal endochondral bone development by chondrocyte-specific targeted expression of parathyroid hormone type 2 receptor.
22637743 2012 Genome-wide gene-environment interaction analysis for asbestos exposure in lung cancer susceptibility.
21756942 2011 PTH-receptors regulate norepinephrine release in human heart and kidney.
19401215 2009 Parathyroid hormone 2 receptor and its endogenous ligand tuberoinfundibular peptide of 39 residues are concentrated in endocrine, viscerosensory and auditory brain regions in macaque and human.
18539702 2008 Ligand-receptor interactions at the parathyroid hormone receptors: subtype binding selectivity is mediated via an interaction between residue 23 on the ligand and residue 41 on the receptor.
18459453 2008 Evidence for the expression of parathyroid hormone 2 receptor in the human brainstem.
18280230 2008 Genetic variation in the PTH pathway and bone phenotypes in elderly women: evaluation of PTH, PTHLH, PTHR1 and PTHR2 genes.
More...