Property Summary

Ligand Count 1
NCBI Gene PubMed Count 24
PubMed Score 27.99
PubTator Score 28.72

Knowledge Summary

Patent (2,494)

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -2.400 1.1e-02
atypical teratoid/rhabdoid tumor 1.100 1.9e-02
Breast cancer -1.100 5.2e-03
ependymoma -2.400 2.4e-02
oligodendroglioma -2.100 2.0e-02
ovarian cancer 2.900 5.6e-04

Gene RIF (11)

AA Sequence

MAGLGASLHVWGWLMLGSCLLARAQLDSDGTITIEEQIVLVLKAKVQCELNITAQLQEGEGNCFPEWDGL      1 - 70
ICWPRGTVGKISAVPCPPYIYDFNHKGVAFRHCNPNGTWDFMHSLNKTWANYSDCLRFLQPDISIGKQEF     71 - 140
FERLYVMYTVGYSISFGSLAVAILIIGYFRRLHCTRNYIHMHLFVSFMLRATSIFVKDRVVHAHIGVKEL    141 - 210
ESLIMQDDPQNSIEATSVDKSQYIGCKIAVVMFIYFLATNYYWILVEGLYLHNLIFVAFFSDTKYLWGFI    211 - 280
LIGWGFPAAFVAAWAVARATLADARCWELSAGDIKWIYQAPILAAIGLNFILFLNTVRVLATKIWETNAV    281 - 350
GHDTRKQYRKLAKSTLVLVLVFGVHYIVFVCLPHSFTGLGWEIRMHCELFFNSFQGFFVSIIYCYCNGEV    351 - 420
QAEVKKMWSRWNLSVDWKRTPPCGSRRCGSVLTTVTHSTSSQSQVAASTRMVLISGKAAKIASRQPDSHI    421 - 490
TLPGYVWSNSEQDCLPHSFHEETKEDSGRQGDDILMEKPSRPMESNPDTEGCQGETEDVL              491 - 550
//

Text Mined References (24)

PMID Year Title