Property Summary

NCBI Gene PubMed Count 27
PubMed Score 53.33
PubTator Score 33.71

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

AA Sequence

MHYPTALLFLILANGAQAFRICAFNAQRLTLAKVAREQVMDTLVRILARCDIMVLQEVVDSSGSAIPLLL      1 - 70
RELNRFDGSGPYSTLSSPQLGRSTYMETYVYFYRSHKTQVLSSYVYNDEDDVFAREPFVAQFSLPSNVLP     71 - 140
SLVLVPLHTTPKAVEKELNALYDVFLEVSQHWQSKDVILLGDFNADCASLTKKRLDKLELRTEPGFHWVI    141 - 210
ADGEDTTVRASTHCTYDRVVLHGERCRSLLHTAAAFDFPTSFQLTEEEALNISDHYPVEVELKLSQAHSV    211 - 280
QPLSLTVLLLLSLLSPQLCPAA                                                    281 - 302
//

Text Mined References (27)

PMID Year Title