Property Summary

NCBI Gene PubMed Count 34
PubMed Score 38.39
PubTator Score 22.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
breast carcinoma 1614 2.192479677637E-37
lung carcinoma 2844 1.17491987157225E-28
Breast cancer 3099 5.74512549390341E-19
ovarian cancer 8492 1.87406960037201E-7
lung cancer 4473 4.89425581915407E-6
malignant mesothelioma 3163 1.23392567412321E-5
invasive ductal carcinoma 2950 1.82326071037052E-4
colon cancer 1475 2.61610142151632E-4
osteosarcoma 7933 0.00191380189591717
subependymal giant cell astrocytoma 2287 0.00710074647420197
medulloblastoma, large-cell 6234 0.0119113094497276
astrocytoma 1493 0.0176260151479082
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 156 0.0 1.0
Disease Target Count Z-score Confidence
Cleft palate 125 3.433 1.7
Disease Target Count
15q14 microdeletion syndrome 1

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
osteosarcoma 1.802 0.002
astrocytoma 1.700 0.018
medulloblastoma, large-cell -2.600 0.012
lung cancer -2.900 0.000
colon cancer -2.500 0.000
subependymal giant cell astrocytoma 1.954 0.007
Breast cancer -3.100 0.000
lung carcinoma 2.700 0.000
breast carcinoma -1.600 0.000
invasive ductal carcinoma -2.500 0.000
ovarian cancer -4.000 0.000

Synonym

Accession O14770 A6NJI5 A8MWD5 B3KP98 B3KPQ6 Q96DI2 Q96KI4 Q96KI5 Q9NRS1 Q9NRS2 Q9NRS3
Symbols MRG1
HsT18361

Gene

PDB

3K2A   4XRM   5BNG  

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Xenopus OMA Inparanoid

Pathway (1)

Gene RIF (16)

PMID Text
26512644 Meis2 as the target of miR-134 in the regulation of cardiomyocyte progenitor cell proliferation.
25712757 This is the first report showing a de novo small intragenic mutation in MEIS2 and further confirms the important role of this gene in normal development.
25210800 FOXM1 is a direct target gene of MEIS2 and is required for MEIS2 to upregulate mitotic genes.
24678003 Our results show that MEIS2 is a gene needed for palate closure. In syndromic cases of cleft palate, MEIS2 should be considered among the candidate genes, for example, in cases without 22q11.2 deletions.
23541832 The data suggest existence of a complex regulatory pathway in the trabecular meshwork part of which includes interactions between FOXC1, miR-204, MEIS2, and ITGbeta1.
21746878 Klf4 recruits a complex of Meis and Pbx proteins to DNA, resulting in Meis2 transcriptional activation domain-dependent activation of a subset of Klf4 target genes.
21368052 Transgenic mice lacking microRNAs miR-9-2 and miR-9-3 exhibit multiple defects of telencephalic structures which may be brought about by dysregulation of Foxg1, Nr2e1, Gsh2, and Meis2 expression.
20553494 This work suggests that the transcriptional activity of all members of the Meis/Prep Hth protein family is subject to autoinhibition by their Hth domains, and that the Meis3.2 splice variant encodes a protein that bypasses this autoinhibitory effect.
20523026 Data demonstrate by in situ hybridization and immunohistochemistry that the two homeobox genes Pax6 and MEIS2 are expressed during early fetal brain development in humans.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVN      1 - 70
DALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSN     71 - 140
PELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNL    141 - 210
ADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKR    211 - 280
GIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLD    281 - 350
PSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGLQSMPGDYVSQGGPMGMSMAQPSYTPPQMTPHPTQLR    351 - 420
HGPPMHSYLPSHPHHPAMMMHGGPPTHPGMTMSAQSPTMLNSVDPNVGGQVMDIHAQ                 421 - 477
//

Text Mined References (36)

PMID Year Title
26512644 2015 miR-134 Modulates the Proliferation of Human Cardiomyocyte Progenitor Cells by Targeting Meis2.
25712757 2015 MEIS2 involvement in cardiac development, cleft palate, and intellectual disability.
25416956 2014 A proteome-scale map of the human interactome network.
25210800 2014 MEIS2 is essential for neuroblastoma cell survival and proliferation by transcriptional control of M-phase progression.
24678003 2014 Haploinsufficiency of MEIS2 is associated with orofacial clefting and learning disability.
24002674 2014 Genome-wide association study and meta-analysis of intraocular pressure.
23541832 2013 FOXC1 in human trabecular meshwork cells is involved in regulatory pathway that includes miR-204, MEIS2, and ITG?1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
21746878 2011 Cooperative transcriptional activation by Klf4, Meis2, and Pbx1.
More...