Property Summary

NCBI Gene PubMed Count 72
PubMed Score 39.06
PubTator Score 56.87

Knowledge Summary

Patent (4,471)

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
Breast cancer 3099 1.37692781881759E-97
breast carcinoma 1614 1.60907535726466E-6
glioblastoma 5572 3.69609365873455E-4
pilocytic astrocytoma 3086 0.00664190862255185
primitive neuroectodermal tumor 3031 0.0163749474560778
astrocytic glioma 2241 0.0181157920998797
oligodendroglioma 2849 0.0209128546397647
non primary Sjogren syndrome sicca 840 0.0216772586448564
ependymoma 2514 0.0278705853062193
medulloblastoma, large-cell 6234 0.0291061109084156
Disease Target Count Z-score Confidence
Obesity 616 3.471 1.7

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.500 0.018
ependymoma -1.600 0.028
oligodendroglioma -1.500 0.021
glioblastoma -1.600 0.000
medulloblastoma, large-cell -1.500 0.029
primitive neuroectodermal tumor -1.400 0.016
pilocytic astrocytoma -1.100 0.007
non primary Sjogren syndrome sicca -1.100 0.022
Breast cancer -4.600 0.000
breast carcinoma -1.200 0.000

Synonym

Accession P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 NPY2-R
Symbols NPY2-R

Gene

PANTHER Protein Class (2)

PDB

2IK3  

  Ortholog (13)

  TechDev Info (1)

MLP Assay (31)

AID Type Active / Inconclusive / Inactive Description
793 screening 1385 / 0 / 138724 Primary cell based high-throughput screening assay for antagonists of neuropeptide Y receptor Y2 (NPY-Y2)
1255 screening 332 / 0 / 863 Counterscreen assay for antagonists of neuropeptide Y receptor Y1 (NPY-Y1): Cell-based high throughput assay to measure NPY-Y2 antagonism
1257 screening 228 / 0 / 479 Cell-based high throughput confirmation assay for antagonists of neuropeptide Y receptor Y2 (NPY-Y2)
1272 confirmatory 72 / 0 / 47 Dose response cell-based screening assay for antagonists of neuropeptide Y receptor Y2 (NPY-Y2)
1278 confirmatory 8 / 0 / 55 Dose response counterscreen assay for neuropeptide Y receptor Y1 (NPY-Y1): Cell-based high throughput assay to measure NPY-Y2 antagonism
1359 screening 971 / 0 / 217146 Primary cell-based high-throughput screening assay for potentiators or agonists of NPY-Y2
1539 screening 92 / 0 / 361 Confirmation cell-based high-throughput screening assay for potentiators or agonists of NPY-Y2
1649 screening 65 / 0 / 216 Fluorescence counterscreen assay for potentiators or agonists of NPY-Y1: Cell-based high-throughput screening assay to identify potentiators or agonists of NPY-Y2.
1698 screening 187 / 0 / 94 Fluorescence counterscreen assay for potentiators or agonists of NPY-Y1: cell-based high-throughput screening assay to identify agonists of NPY-Y2.
1710 screening 253 / 0 / 200 Fluorescence-based counterscreen assay for potentiators of NPY-Y2: cell-based high-throughput screening assay to identify agonists of NPY-Y2.
More...

Gene RIF (65)

PMID Text
25924821 The C-terminal alpha-helix of Neuropeptide Y, which is formed in a membrane environment in the absence of the receptor, is unwound starting at T(32) to provide optimal contacts in a binding pocket within the transmembrane bundle of the NPY-Y2 receptor.
25871004 polymorphisms in the NPY2R gene may be useful in identifying women at risk for osteoporosis.
25157429 Data show that the Y2-receptor high expression G allele is associated with a less efficient mode of action cascading where different task goals are activated in parallel.
24709141 The results of this study provide evidence that the functionally relevant single nucleotide polymorphism (SNP) in the NPY2R promoter gene affect circumscribed processes of early sensory processing
24623336 The molecular mobility of the human neuropeptide Y receptor type 2 reconstituted into dimyristoylphosphatidylcholine (DMPC) membranes was investigated by means of solid-state NMR spectroscopy.
24365162 This study reviews neuropeptide Y2 receptor modulators (mainly non-peptidic antagonists) and their structure-activity relationships.
24121255 Data indicate modest association of the age at onset (AO) with two neuropeptide Y (NPY) promoter variations and a highly significant association with NPY receptor NPY2R promoter single nucleotide polymorphism (SNP rs2234759).
23149563 this study concludes that common genetic variation in the proximal NPY2R promoter influences transcription factor binding so as to alter gene expression in neuroendocrine cells, and consequently cardiometabolic traits in humans.
23020974 we determined the role of the C-terminus in the anterograde transport of the human neuropeptide Y receptor (hYR) type 2
22732667 Surface masking of the Y2 receptor could to a degree reflect restricted access of the large (34-36-residue) physiological agonists.
More...

AA Sequence

MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSL      1 - 70
VIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTIT     71 - 140
LTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGE    141 - 210
EKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVS    211 - 280
WLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIH    281 - 350
SEVSVTFKAKKNLEVRKNSGPNDSFTEATNV                                           351 - 381
//

Text Mined References (73)

PMID Year Title
25924821 2015 Unwinding of the C-Terminal Residues of Neuropeptide Y is critical for Y? Receptor Binding and Activation.
25871004 2015 Polymorphisms in neuropeptide genes and bone mineral density in Korean postmenopausal women.
25157429 2014 On the relevance of the NPY2-receptor variation for modes of action cascading processes.
24709141 2014 NPY2-receptor variation modulates iconic memory processes.
24623336 2014 The G-protein-coupled neuropeptide Y receptor type 2 is highly dynamic in lipid membranes as revealed by solid-state NMR spectroscopy.
24365162 2014 Ligands of the neuropeptide Y Y2 receptor.
24121255 2014 Association of age at onset in Huntington disease with functional promoter variations in NPY and NPY2R.
23597562 2013 Inhibition of tumor angiogenesis and growth by a small-molecule multi-FGF receptor blocker with allosteric properties.
23149563 2013 Heredity and cardiometabolic risk: naturally occurring polymorphisms in the human neuropeptide Y(2) receptor promoter disrupt multiple transcriptional response motifs.
23020974 2012 The anterograde transport of the human neuropeptide Y2 receptor is regulated by a subtype specific mechanism mediated by the C-terminus.
More...