Property Summary

Ligand Count 100
NCBI Gene PubMed Count 75
PubMed Score 42.56
PubTator Score 56.87

Knowledge Summary

Patent (4,471)

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.500 1.8e-02
Astrocytoma, Pilocytic -1.100 7.0e-03
Breast cancer -4.600 1.4e-97
breast carcinoma -1.200 1.6e-06
ependymoma -1.600 2.8e-02
glioblastoma -1.600 3.7e-04
medulloblastoma, large-cell -1.500 2.9e-02
non primary Sjogren syndrome sicca -1.100 2.2e-02
oligodendroglioma -1.500 2.1e-02
primitive neuroectodermal tumor -1.400 1.6e-02

Gene RIF (68)

AA Sequence

MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSL      1 - 70
VIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTIT     71 - 140
LTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGE    141 - 210
EKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVS    211 - 280
WLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIH    281 - 350
SEVSVTFKAKKNLEVRKNSGPNDSFTEATNV                                           351 - 381
//

Text Mined References (76)

PMID Year Title