Property Summary

NCBI Gene PubMed Count 118
Grant Count 34
R01 Count 25
Funding $1,895,252.43
PubMed Score 135.60
PubTator Score 280.02

Knowledge Summary

Patent (10,886)

Expression

  Differential Expression (16)

Disease log2 FC p
psoriasis -1.300 0.000
glioblastoma 2.900 0.000
osteosarcoma 1.498 0.000
posterior fossa group A ependymoma 1.500 0.000
atypical teratoid / rhabdoid tumor 1.800 0.000
medulloblastoma 1.500 0.004
medulloblastoma, large-cell 1.600 0.003
primitive neuroectodermal tumor 1.200 0.003
pediatric high grade glioma 2.000 0.000
pilocytic astrocytoma 1.100 0.020
COPD -1.200 0.007
breast carcinoma 1.100 0.000
invasive ductal carcinoma 1.700 0.001
ulcerative colitis 1.300 0.001
pituitary cancer -1.200 0.003
dermatomyositis -1.200 0.005

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (62)

PMID Text
26616734 CEP131 is the key regulatory target of MK2 and 14-3-3 in centriolar satellite remodeling.
26280535 mTOR controls the senescence-associated secretory phenotype by differentially regulating the translation of the MK2 (also known as MAPKAPK2).
26169728 MK2 overexpression is associated with primary liver tumors.
26124331 The protein expression of both HMGB1 and MAPKAPK2 were increased in KLM1-R cells.
25693418 findings reveal MK2/MK3 as crucial stress-responsive kinases that promote autophagy through Beclin 1 S90 phosphorylation
25410865 Treatment with MK2 or p38 inhibitors blocked human papillomavirus genome amplification, identifying the p38/MK2 pathway as a key regulator of the human papillomavirus life cycle.
25255283 Data indicate the binding mode and molecular mechanism of action of MAPK-activated protein kinase-2 (MK2) and inhibitors.
25204651 IscU is a new substrate of MK2 both in Drosophila cells and in human cells
25019640 Low pMK2 expression was found to correlate significantly with overall survival after induction plus chemoradiation therapy in head and neck squamous cell carcinoma patients.
24964076 a key role of MK2 and FasR in the regulation and limitation of the immune response in the CNS
More...

AA Sequence

MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVL      1 - 70
GLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMEC     71 - 140
LDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGF    141 - 210
AKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIR    211 - 280
MGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWE    281 - 350
DVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH                        351 - 400
//

Text Mined References (134)

PMID Year Title
26616734 2015 p38- and MK2-dependent signalling promotes stress-induced centriolar satellite remodelling via 14-3-3-dependent sequestration of CEP131/AZI1.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26280535 2015 mTOR regulates MAPKAPK2 translation to control the senescence-associated secretory phenotype.
26169728 2015 Mitogen-activated protein kinase-activated protein kinase 2 mediates resistance to hydrogen peroxide-induced oxidative stress in human hepatobiliary cancer cells.
26124331 2015 High-mobility Group Box 1 and Mitogen-activated Protein Kinase activated Protein Kinase-2 Are Up-regulated in Gemcitabine-resistant Pancreatic Cancer Cells.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25693418 2015 The stress-responsive kinases MAPKAPK2/MAPKAPK3 activate starvation-induced autophagy through Beclin 1 phosphorylation.
25410865 2015 p38MAPK and MK2 pathways are important for the differentiation-dependent human papillomavirus life cycle.
25255283 2015 Discovery and characterization of MAPK-activated protein kinase-2 prevention of activation inhibitors.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
More...