Property Summary

NCBI Gene PubMed Count 89
Grant Count 232
R01 Count 147
Funding $17,114,766.68
PubMed Score 43.36
PubTator Score 61.44

Knowledge Summary

Patent (24,606)

Expression

  Differential Expression (9)

Synonym

Accession P49116 A8K3H5 B6ZGT8 P55092
Symbols TR4
TAK1

Gene

PDB

3P0U  

  TechDev Info (2)

Steve Finkbeiner Neuron specific phenotypes being screened
Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

 GO Component (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (62)

PMID Text
26884850 TAK1/TAB1 expression in non-small cell lung carcinoma tissue is significantly increased and closely associated with patient clinical prognosis.
26620228 Together, these results demonstrate that LYTAK1 inhibits LPS-induced production of several pro-inflammatory cytokines and endotoxin shock probably through blocking TAK1-regulated signalings.
26617776 miR-203 represses NF-kappaB signaling via targeting TAK1 and PI3KCA and miR-203 overexpression may contribute to the COPD initiation.
26432169 DK1 inhibits the formation of the TAK1-TAB2-TRAF6 complex and leads to the inhibition of TRAF6 ubiquitination.
26334375 IFIT5 promotes SeV-induced IKK phosphorylation and NF-kappaB activation by regulating the recruitment of IKK to TAK1.
26240016 USP18 negatively regulates NF-kappaB signaling by targeting TAK1 and NEMO for deubiquitination through distinct mechanisms.
26178291 TR4 was found to mediate the prostate cancer cells' radio-sensitivity.
26144287 TR4 expression in NSCLC samples is significantly associated with poor clinicopathological features, and TR4 plays an important role in the metastatic capacity of NSCLC cells by EMT regulation.
25980442 TR4 may increase prostate cancer metastasis and invasion via decreasing the miR-373-3p expression that resulted in the activation of the TGFbetaR2/p-Smad3 signals.
25925376 PCa patients receiving TZD treatment who have one allele TR4 deletion.
More...

AA Sequence

MTSPSPRIQIISTDSAVASPQRIQIVTDQQTGQKIQIVTAVDASGSPKQQFILTSPDGAGTGKVILASPE      1 - 70
TSSAKQLIFTTSDNLVPGRIQIVTDSASVERLLGKTDVQRPQVVEYCVVCGDKASGRHYGAVSCEGCKGF     71 - 140
FKRSVRKNLTYSCRSNQDCIINKHHRNRCQFCRLKKCLEMGMKMESVQSERKPFDVQREKPSNCAASTEK    141 - 210
IYIRKDLRSPLIATPTFVADKDGARQTGLLDPGMLVNIQQPLIREDGTVLLATDSKAETSQGALGTLANV    211 - 280
VTSLANLSESLNNGDTSEIQPEDQSASEITRAFDTLAKALNTTDSSSSPSLADGIDTSGGGSIHVISRDQ    281 - 350
STPIIEVEGPLLSDTHVTFKLTMPSPMPEYLNVHYICESASRLLFLSMHWARSIPAFQALGQDCNTSLVR    351 - 420
ACWNELFTLGLAQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNSMAKLDIDGY    421 - 490
EYAYLKAIVLFSPDHPGLTSTSQIEKFQEKAQMELQDYVQKTYSEDTYRLARILVRLPALRLMSSNITEE    491 - 560
LFFTGLIGNVSIDSIIPYILKMETAEYNGQITGASL                                      561 - 596
//

Text Mined References (101)

PMID Year Title
26884850 2015 Expression of TAK1/TAB1 expression in non-small cell lung carcinoma and adjacent normal tissues and their clinical significance.
26620228 2016 LYATK1 potently inhibits LPS-mediated pro-inflammatory response.
26617776 2015 Ectopic expressed miR-203 contributes to chronic obstructive pulmonary disease via targeting TAK1 and PIK3CA.
26432169 2015 Phosphoinositide-dependent kinase-1 inhibits TRAF6 ubiquitination by interrupting the formation of TAK1-TAB2 complex in TLR4 signaling.
26334375 2015 IFIT5 positively regulates NF-?B signaling through synergizing the recruitment of I?B kinase (IKK) to TGF-?-activated kinase 1 (TAK1).
26240016 2015 USP18 negatively regulates NF-?B signaling by targeting TAK1 and NEMO for deubiquitination through distinct mechanisms.
26178291 2015 Testicular orphan nuclear receptor 4 is associated with the radio-sensitivity of prostate cancer.
26144287 2015 Testicular orphan receptor 4 (TR4) is a marker for metastasis and poor prognosis in non-small cell lung cancer that drives the EMT phenotype.
25980442 2015 TR4 nuclear receptor increases prostate cancer invasion via decreasing the miR-373-3p expression to alter TGF?R2/p-Smad3 signals.
25925376 2015 The Differential Effects of Anti-Diabetic Thiazolidinedione on Prostate Cancer Progression Are Linked to the TR4 Nuclear Receptor Expression Status.
More...