Property Summary

NCBI Gene PubMed Count 26
Grant Count 37
R01 Count 24
Funding $2,974,506.25
PubMed Score 74.66
PubTator Score 39.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 2.093 0.000
ovarian cancer -1.600 0.000

Gene RIF (12)

PMID Text
23879967 A novel interaction between calcium-modulating cyclophilin ligand and Basigin regulates calcium signaling and matrix metalloproteinase activities in human melanoma cells.
23266901 Found that the calcium-modulating cyclophilin ligand (CAMLG), which is involved in Ca(2+) signaling, was the major host cell PilA binding protein.
23041287 Results indicate calcium-modulating cyclophilin ligand (CAML) and WRB as components of the TRC40 receptor complex and a crucial mechanism for driving ER membrane insertion of TA proteins in mammalian cells.
22281498 this study demonstrated that DENV manipulated the levels of CAML to subvert the apoptotic process which in turn favoured efficient virus production.
21128111 CAML was found to play a crucial role in the PRL/PRLR-dependent growth of breast cancer cells.
20485444 Observational study of gene-disease association. (HuGE Navigator)
20126395 Data show that tetherin restricts particle release and does not require CAML for this effect.
19135167 Binding of the MUC1 CT to CAML in human epithelial cells was confirmed by reciprocal coimmunoprecipitations, confocal microscopy, protein crosslinking, and coupled transcription/translation analyses.
16243292 The intracellular C-terminus of fibrocystin interacts with CAML, a protein with an intracellular distribution that is similar to that of PKD2.
15668245 CAML is an important signal transducer for the actions of Ang II in regulating the calcineurin-NFAT pathway and the interaction of CAML with ATRAP may mediate the Ang II actions in vascular physiology
More...

AA Sequence

MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDS      1 - 70
DKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSSDVNLELRQRNRGDLT     71 - 140
ADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEEFDSFRIFRLVGCALLALGVRAFVCKY    141 - 210
LSIFAPFLTLQLAYMGLYKYFPKSEKKIKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFT    211 - 280
FIFCHELLDYWGSEVP                                                          281 - 296
//

Text Mined References (31)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24392163 2014 WRB and CAML are necessary and sufficient to mediate tail-anchored protein targeting to the ER membrane.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23879967 2013 A novel interaction between calcium-modulating cyclophilin ligand and Basigin regulates calcium signaling and matrix metalloproteinase activities in human melanoma cells.
23266901 2013 Type IV pilus protein PilA of Pseudomonas aeruginosa modulates calcium signaling through binding the calcium-modulating cyclophilin ligand.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23041287 2012 Molecular machinery for insertion of tail-anchored membrane proteins into the endoplasmic reticulum membrane in mammalian cells.
22281498 2012 Dengue virus utilizes calcium modulating cyclophilin-binding ligand to subvert apoptosis.
21269460 2011 Initial characterization of the human central proteome.
More...