Property Summary

NCBI Gene PubMed Count 26
PubMed Score 78.82
PubTator Score 39.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 2.093 1.5e-04
ovarian cancer -1.600 1.8e-06

Gene RIF (12)

AA Sequence

MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDS      1 - 70
DKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSSDVNLELRQRNRGDLT     71 - 140
ADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEEFDSFRIFRLVGCALLALGVRAFVCKY    141 - 210
LSIFAPFLTLQLAYMGLYKYFPKSEKKIKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFT    211 - 280
FIFCHELLDYWGSEVP                                                          281 - 296
//

Text Mined References (31)

PMID Year Title